DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gfrl and Gfra4

DIOPT Version :9

Sequence 1:NP_001247206.1 Gene:Gfrl / 3346162 FlyBaseID:FBgn0262869 Length:1279 Species:Drosophila melanogaster
Sequence 2:XP_006235103.1 Gene:Gfra4 / 66023 RGDID:620503 Length:347 Species:Rattus norvegicus


Alignment Length:223 Identity:52/223 - (23%)
Similarity:83/223 - (37%) Gaps:49/223 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   641 CHTALDTCREDPSCSSSLQPMLTHCELHR--------CNRNACMSSLQAFY-KGPHEDLNLDIAF 696
            |..|.:.|..|..|.......:..| |.|        |.|:.|..:|:.|: :|| ..|...:.|
  Rat    98 CVEAAEACTADEQCQQLRSEYVAQC-LGRAGWRGPGSCVRSRCRRALRRFFARGP-PALTHALLF 160

  Fly   697 CLCKKTSSQQNGNGNRHDMCMIAQEKLHPVCAQRPPDNSNPASSNGIYYHPPPACHVVADSCKED 761
            |.|:                       .|.||:|......||.:.......||:|....|.|:..
  Rat   161 CGCE-----------------------GPACAERRRQTFAPACAFSGPQLAPPSCLKPLDRCERS 202

  Fly   762 RECRLKLEYYEQACAVDSVTKKCAGRPSG--CRTAMIGILGTMLRTT------------CACQGT 812
            |.||.:|..::.:||....::.......|  |..|..|::||::...            |.|:.:
  Rat   203 RRCRPRLFAFQASCAPAPGSRDGCPEEGGPRCLRAYAGLVGTVVTPNYLDNVSARVAPWCGCEAS 267

  Fly   813 DPQHLYQCVGWRRLLWMNPCVVEAQKDF 840
            ..:. .:|..:|:|...|||:..|.:.|
  Rat   268 GNRR-EECEAFRKLFTRNPCLDGAIQAF 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GfrlNP_001247206.1 GDNF 94..173 CDD:280506
GDNF 193..270 CDD:197975
GDNF 641..727 CDD:197975 20/94 (21%)
GDNF 751..832 CDD:280506 21/94 (22%)
Gfra4XP_006235103.1 GDNF 98..180 CDD:280506 24/106 (23%)
GDNF 192..286 CDD:280506 21/94 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343948
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10269
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.