DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gfrl and gfral

DIOPT Version :9

Sequence 1:NP_001247206.1 Gene:Gfrl / 3346162 FlyBaseID:FBgn0262869 Length:1279 Species:Drosophila melanogaster
Sequence 2:XP_689825.7 Gene:gfral / 561326 ZFINID:ZDB-GENE-110607-2 Length:433 Species:Danio rerio


Alignment Length:200 Identity:45/200 - (22%)
Similarity:68/200 - (34%) Gaps:40/200 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   636 HFQSTCHTALDTCREDPSCSSSLQPMLTHCELHRCNRNACMSSLQAFYKGPHEDLNLDIAFCLCK 700
            |....|...:..|..:.||:..:.|:|..|:...||:  |..:::.||......:...:.||.| 
Zfish   125 HADRPCLEEIAACLGEESCNRPMVPLLQECKASSCNQ--CTEAIRQFYSALPHSVAETLVFCEC- 186

  Fly   701 KTSSQQNGNGNRHDMCMIAQEKLH-PVCAQRPPDNSNPASSNGIYYHPPPACHVVADSCKEDREC 764
                     |.:...|...:..:| ..|.......             |..|....|||.||..|
Zfish   187 ---------GAQDQQCQEMKALIHYGSCVSEQTQT-------------PWTCLEALDSCFEDASC 229

  Fly   765 RLKLEYYEQAC------AVDSVTKKC--------AGRPSGCRTAMIGILGTMLRTTCACQGTDPQ 815
            |...:.:...|      |.||.:...        .|....||.|.:..:|::|...|.|.|....
Zfish   230 RQVFDGFLSKCFEAEESAFDSTSDWLYLLDPDFFLGEDVECRAAFVETVGSVLHHPCTCAGLHHH 294

  Fly   816 HLYQC 820
            |.|:|
Zfish   295 HQYKC 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GfrlNP_001247206.1 GDNF 94..173 CDD:280506
GDNF 193..270 CDD:197975
GDNF 641..727 CDD:197975 18/86 (21%)
GDNF 751..832 CDD:280506 23/83 (28%)
gfralXP_689825.7 GDNF 130..205 CDD:308135 18/86 (21%)
GDNF 216..310 CDD:308135 23/83 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584247
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10269
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5065
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.