Sequence 1: | NP_001247206.1 | Gene: | Gfrl / 3346162 | FlyBaseID: | FBgn0262869 | Length: | 1279 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_689825.7 | Gene: | gfral / 561326 | ZFINID: | ZDB-GENE-110607-2 | Length: | 433 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 45/200 - (22%) |
---|---|---|---|
Similarity: | 68/200 - (34%) | Gaps: | 40/200 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 636 HFQSTCHTALDTCREDPSCSSSLQPMLTHCELHRCNRNACMSSLQAFYKGPHEDLNLDIAFCLCK 700
Fly 701 KTSSQQNGNGNRHDMCMIAQEKLH-PVCAQRPPDNSNPASSNGIYYHPPPACHVVADSCKEDREC 764
Fly 765 RLKLEYYEQAC------AVDSVTKKC--------AGRPSGCRTAMIGILGTMLRTTCACQGTDPQ 815
Fly 816 HLYQC 820 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gfrl | NP_001247206.1 | GDNF | 94..173 | CDD:280506 | |
GDNF | 193..270 | CDD:197975 | |||
GDNF | 641..727 | CDD:197975 | 18/86 (21%) | ||
GDNF | 751..832 | CDD:280506 | 23/83 (28%) | ||
gfral | XP_689825.7 | GDNF | 130..205 | CDD:308135 | 18/86 (21%) |
GDNF | 216..310 | CDD:308135 | 23/83 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170584247 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10269 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5065 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.970 |