DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gfrl and GFRA2

DIOPT Version :9

Sequence 1:NP_001247206.1 Gene:Gfrl / 3346162 FlyBaseID:FBgn0262869 Length:1279 Species:Drosophila melanogaster
Sequence 2:NP_001486.4 Gene:GFRA2 / 2675 HGNCID:4244 Length:464 Species:Homo sapiens


Alignment Length:335 Identity:77/335 - (22%)
Similarity:112/335 - (33%) Gaps:94/335 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KILSCCLSLWVVLFGGALHLAQGSEFPERECCDLTTTSTVGPLPMPPAALPTDKSLSSATTALET 74
            |.|.|....|.:..|    |.:|.||.|..             |..|            .|:..:
Human   101 KELQCLQIYWSIHLG----LTEGEEFYEAS-------------PYEP------------VTSRLS 136

  Fly    75 D---LAIGRSGSTIKGVVAIL--NCILARQLCFEDPSC----SAILEIIPRVCGPIPVSCSTVTV 130
            |   ||...||:....||:..  :|:.|.:.|..:.:|    |:.:.|..|...|.. .|:.   
Human   137 DIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTE-RCNR--- 197

  Fly   131 TKCQAALRTLQAFQFFR--PT--------CLCKEPGMDPDCNHFRDFLFDHPCGFVLKKAEKDPY 185
            .||..|||     |||.  |:        |.|:    |..|...|.......|.:  :..||   
Human   198 RKCHKALR-----QFFDRVPSEYTYRMLFCSCQ----DQACAERRRQTILPSCSY--EDKEK--- 248

  Fly   186 PIDALPTCNHALSVCQQERKCLKLFEDFKTHCKV---RDNKCKMENRDACHDSW----------- 236
                 |.|.....||:.:..|.....||..:|:.   ....|..:|..||..|:           
Human   249 -----PNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPN 308

  Fly   237 ------TNLRLSPMFGCICPNNHMKKRCDRIFNIVNHNPCVDRLI-FFPNGLPKLKQPR-PKAKP 293
                  |.:.:||...|....| |::.|::.......|||:...| .|.||......|: |..:.
Human   309 YVDSSPTGIVVSPWCSCRGSGN-MEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQA 372

  Fly   294 RPKPKPKSKP 303
            ...|:.:..|
Human   373 TQAPRVEKTP 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GfrlNP_001247206.1 GDNF 94..173 CDD:280506 23/92 (25%)
GDNF 193..270 CDD:197975 20/96 (21%)
GDNF 641..727 CDD:197975
GDNF 751..832 CDD:280506
GFRA2NP_001486.4 GDNF 40..113 CDD:197975 4/11 (36%)
GDNF 161..241 CDD:308135 23/92 (25%)
GDNF 251..347 CDD:308135 20/96 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 363..392 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150021
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10269
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.