DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gfrl and Gfra1

DIOPT Version :9

Sequence 1:NP_001247206.1 Gene:Gfrl / 3346162 FlyBaseID:FBgn0262869 Length:1279 Species:Drosophila melanogaster
Sequence 2:NP_037091.1 Gene:Gfra1 / 25454 RGDID:2681 Length:468 Species:Rattus norvegicus


Alignment Length:364 Identity:78/364 - (21%)
Similarity:120/364 - (32%) Gaps:105/364 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   618 YQS--GQDVEVDLSTE--------------IIKQHFQ--------STCHTALDTCREDPSC---- 654
            |||  |.|:..|...|              .|...||        :.|..|...|..|.:|    
  Rat   107 YQSLQGNDLLEDSPYEPVNSRLSDIFRAVPFISDVFQQVEHISKGNNCLDAAKACNLDDTCKKYR 171

  Fly   655 SSSLQPMLTHCELHRCNRNACMSSLQAFYKGPHEDLNLDIAFCLCKKTSSQQNGNGNRHDMCMIA 719
            |:.:.|..|......|||..|..:|:.|:.......:..:.||.|:..:..:.           .
  Rat   172 SAYITPCTTSMSNEVCNRRKCHKALRQFFDKVPAKHSYGMLFCSCRDIACTER-----------R 225

  Fly   720 QEKLHPVCAQRPPDNSNPASSNGIYYHPPPACHVVADSCKEDRECRLKLEYYEQACAVD--SVTK 782
            ::.:.|||:....:.              |.|..:.||||.:..||.:|..:...|..:  ||:.
  Rat   226 RQTIVPVCSYEERER--------------PNCLSLQDSCKTNYICRSRLADFFTNCQPESRSVSN 276

  Fly   783 KCAGRPSGCRTAMIGILGTMLRTT--------------CACQGTDPQHLYQCVGWRRLLWMNPCV 833
            ......:.|..|..|::||::...              |:..|.|   |..|:.:......|.|:
  Rat   277 CLKENYADCLLAYSGLIGTVMTPNYVDSSSLSVAPWCDCSNSGND---LEDCLKFLNFFKDNTCL 338

  Fly   834 VEAQKDFHMKRLAELGFLTTTTTTTTTTTTTTTTTTTRAPPPPPPPTTTTTTTTSMQPRQTPRKP 898
            ..|.:.|                       ...:..|...|.||..|||.||||:.:.:..|..|
  Rat   339 KNAIQAF-----------------------GNGSDVTMWQPAPPVQTTTATTTTAFRVKNKPLGP 380

  Fly   899 A-------THIF---KDVITAKEKSEPTSVEHNYLDPPD 927
            |       ||:.   .::...|.||..:...|..|...|
  Rat   381 AGSENEIPTHVLPPCANLQAQKLKSNVSGSTHLCLSDSD 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GfrlNP_001247206.1 GDNF 94..173 CDD:280506
GDNF 193..270 CDD:197975
GDNF 641..727 CDD:197975 18/89 (20%)
GDNF 751..832 CDD:280506 22/96 (23%)
Gfra1NP_037091.1 Repetitive region 25..113 3/5 (60%)
GDNF 29..107 CDD:396776 78/364 (21%)
Repetitive region 150..238 20/98 (20%)
GDNF 154..233 CDD:197975 18/89 (20%)
Repetitive region 239..342 24/119 (20%)
GDNF 243..337 CDD:396776 22/96 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10269
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.