powered by:
Protein Alignment Gfrl and Y53G8AM.6
DIOPT Version :9
Sequence 1: | NP_001247206.1 |
Gene: | Gfrl / 3346162 |
FlyBaseID: | FBgn0262869 |
Length: | 1279 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001368041.1 |
Gene: | Y53G8AM.6 / 190238 |
WormBaseID: | WBGene00021806 |
Length: | 121 |
Species: | Caenorhabditis elegans |
Alignment Length: | 51 |
Identity: | 16/51 - (31%) |
Similarity: | 20/51 - (39%) |
Gaps: | 11/51 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 756 DSCKEDRECRLKLEYYEQA-CAVDSVTKKC--------AGRPSGCRTAMIG 797
||.::...||.|.|..:.. |..| |.|| ||..|...|.:.|
Worm 59 DSLQKTIGCRYKCEENDAINCKND--TLKCFFSPYYPAAGWLSNITTGLPG 107
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
1 | 0.960 |
|
Return to query results.
Submit another query.