DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gfrl and Y53G8AM.6

DIOPT Version :9

Sequence 1:NP_001247206.1 Gene:Gfrl / 3346162 FlyBaseID:FBgn0262869 Length:1279 Species:Drosophila melanogaster
Sequence 2:NP_001368041.1 Gene:Y53G8AM.6 / 190238 WormBaseID:WBGene00021806 Length:121 Species:Caenorhabditis elegans


Alignment Length:51 Identity:16/51 - (31%)
Similarity:20/51 - (39%) Gaps:11/51 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   756 DSCKEDRECRLKLEYYEQA-CAVDSVTKKC--------AGRPSGCRTAMIG 797
            ||.::...||.|.|..:.. |..|  |.||        ||..|...|.:.|
 Worm    59 DSLQKTIGCRYKCEENDAINCKND--TLKCFFSPYYPAAGWLSNITTGLPG 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GfrlNP_001247206.1 GDNF 94..173 CDD:280506
GDNF 193..270 CDD:197975
GDNF 641..727 CDD:197975
GDNF 751..832 CDD:280506 16/51 (31%)
Y53G8AM.6NP_001368041.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.