DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gfrl and Gfra3

DIOPT Version :9

Sequence 1:NP_001247206.1 Gene:Gfrl / 3346162 FlyBaseID:FBgn0262869 Length:1279 Species:Drosophila melanogaster
Sequence 2:NP_034410.3 Gene:Gfra3 / 14587 MGIID:1201403 Length:397 Species:Mus musculus


Alignment Length:229 Identity:54/229 - (23%)
Similarity:88/229 - (38%) Gaps:61/229 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   640 TCHTALDTCRE--DPSCSSSLQPMLTHCELHRCNRNACMSSLQAFYKGPHEDLNLDIAFCLCKKT 702
            |.|...|..|:  ..:||..           ||.|:.|::.|::|::...|.....:..|.|   
Mouse   167 TLHDKCDRLRKAYGEACSGI-----------RCQRHLCLAQLRSFFEKAAESHAQGLLLCPC--- 217

  Fly   703 SSQQNGNGNRHDMCMIAQEKLHPVCAQRPPDNSNPASSNGIYYHPPPACHVVADSCKEDRECRLK 767
            :.:..|.|.|.      :..:.|.||.       |:.:        |.|..:...|:.|..||.:
Mouse   218 APEDAGCGERR------RNTIAPSCAL-------PSVT--------PNCLDLRSFCRADPLCRSR 261

  Fly   768 LEYYEQACAVDSVTKKCAGRPSGCRTAMIGILGTML--------RTT----CACQGT----DPQH 816
            |..::..|....:...||...|.|..|.:|::||.:        .||    |.|:|:    |   
Mouse   262 LMDFQTHCHPMDILGTCATEQSRCLRAYLGLIGTAMTPNFISKVNTTVALSCTCRGSGNLQD--- 323

  Fly   817 LYQCVGWRRLLWMNPCVVE---AQKDFHMKRLAE 847
              :|....|....|||:||   |:..||.:..::
Mouse   324 --ECEQLERSFSQNPCLVEAIAAKMRFHRQLFSQ 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GfrlNP_001247206.1 GDNF 94..173 CDD:280506
GDNF 193..270 CDD:197975
GDNF 641..727 CDD:197975 18/87 (21%)
GDNF 751..832 CDD:280506 24/96 (25%)
Gfra3NP_034410.3 GDNF 41..118 CDD:197975
GDNF 159..236 CDD:280506 19/88 (22%)
GDNF 245..337 CDD:280506 24/96 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840073
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10269
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.