DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and DIP-epsilon

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:408 Identity:85/408 - (20%)
Similarity:134/408 - (32%) Gaps:141/408 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CLVPLWLLLFLD------CGMVGGEVPPH-YWETPYSQPYFDNSSRREVTATVGQAALLHCRVRN 71
            ||:...:.|..|      .|.|||....: ..|.|......:|     :|...|:...|.|.|:|
  Fly    18 CLIASSVALSTDTGSEGNAGNVGGSTLNNVISEDPEFTDVIEN-----ITVPAGRNVKLACSVKN 77

  Fly    72 LGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDE--WTLRISSPQPRDSGTYECQVST- 133
            ||...|:|:......||||.....|.:.|....|.:....  |.|.|::.|..|.|.|.||::| 
  Fly    78 LGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTV 142

  Fly   134 EPKISQGFRLNVVV--SRAKILGNAELFIKSGSDINLTCLAMQSP-------------------- 176
            ..|...|| :.|||  :....|.::::.::.|.::.|.|.|..||                    
  Fly   143 TAKTQYGF-VKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTL 206

  Fly   177 ------------------------------VPPSF------------IYWYKGKRV--------- 190
                                          ||||.            :.|...:.|         
  Fly   207 EVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNIT 271

  Fly   191 -----------MNYSQRGGINVITERS-------------TRTSKLLIAKATPADSGNYTC---S 228
                       :||..|....:|||.|             ..|.:|.|.....:|.|||.|   :
  Fly   272 LECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVAKN 336

  Fly   229 PSSSDSASVVVHVINGEHPAAMQHGNSSATCLRPLSSTSVPFVLATWMSMTV------------- 280
            |......::.:::   ..|...|...::.| ||..::|:....|..:::..:             
  Fly   337 PRGDMDGNIKLYM---SSPPTTQPPPTTTT-LRRTTTTAAEIALDGYINTPLNGNGIGIVGEGPT 397

  Fly   281 --------ASVAWNSNLN 290
                    :|:.:.||||
  Fly   398 NSVIASGKSSIKYLSNLN 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 30/95 (32%)
IG_like 53..145 CDD:214653 30/94 (32%)
ig 153..227 CDD:278476 27/168 (16%)
IG_like 161..>227 CDD:214653 26/160 (16%)
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 32/101 (32%)
Ig 69..139 CDD:143165 23/69 (33%)
IG_like 165..249 CDD:214653 10/83 (12%)
IGc2 172..237 CDD:197706 6/64 (9%)
IG_like 267..348 CDD:214653 16/80 (20%)
Ig 270..339 CDD:299845 16/68 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.