DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and IGSF9

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001128522.1 Gene:IGSF9 / 57549 HGNCID:18132 Length:1179 Species:Homo sapiens


Alignment Length:245 Identity:58/245 - (23%)
Similarity:93/245 - (37%) Gaps:59/245 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PPHYWETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSW-IRKRDLHILTVGILTYTN 97
            ||.:.|||  ....:......||        |.|..|......|:| :|.:||            
Human   135 PPQFQETP--PAVLEVQELEPVT--------LRCVARGSPLPHVTWKLRGKDL------------ 177

  Fly    98 DQRFQSLHSEGSDE-----WTLRISSPQPRDSGTYECQV-STEPKISQGFRLNVVVSRAKILGNA 156
                    .:|..:     .||||...:...||.|.||. |||...:...:|.|:.....::...
Human   178 --------GQGQGQVQVQNGTLRIRRVERGSSGVYTCQASSTEGSATHATQLLVLGPPVIVVPPK 234

  Fly   157 ELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQ-RGGINVITERSTRTSKLLIAKATPA 220
            ...:.:..|::|.|.|...|...::.::.....|.:.|: :..:.::.:.|.|    |:| ..|.
Human   235 NSTVNASQDVSLACHAEAYPANLTYSWFQDNINVFHISRLQPRVRILVDGSLR----LLA-TQPD 294

  Fly   221 DSGNYTCSPSSSDSASVVVHVING-EHPAAMQHGNSSATCLRPLSSTSVP 269
            |:|.|||.||            || .||.:   .::..|.|.|...|::|
Human   295 DAGCYTCVPS------------NGLLHPPS---ASAYLTVLYPAQVTAMP 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 24/99 (24%)
IG_like 53..145 CDD:214653 24/98 (24%)
ig 153..227 CDD:278476 15/74 (20%)
IG_like 161..>227 CDD:214653 15/66 (23%)
IGSF9NP_001128522.1 Ig 24..132 CDD:299845
IG_like 28..110 CDD:214653
I-set 136..223 CDD:254352 28/116 (24%)
Ig 154..220 CDD:143165 23/93 (25%)
Ig_3 226..305 CDD:290638 19/95 (20%)
IG_like 233..319 CDD:214653 23/105 (22%)
Ig 341..404 CDD:299845
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 606..626
FN3 625..715 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 767..919
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 940..988
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1015..1079
PDZ-binding. /evidence=ECO:0000250 1177..1179
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.