DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and CG34353

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:253 Identity:66/253 - (26%)
Similarity:105/253 - (41%) Gaps:40/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SQPYFDNSSRREVTATV-GQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHS 106
            ::|.|  .||.|....: |:..:|.|.|.|.....|:|  ||.:.|||.|.:..|.|.|.:.::.
  Fly    84 NEPMF--ISRSETFKFITGETIVLPCEVANTDTYVVAW--KRGIAILTAGSVKVTPDPRVRLVNG 144

  Fly   107 EGSDEWTLRISSPQPRDSGTYECQVST-EPK-ISQGFRLNVVVSRAKILGNAELFIKSGSDINLT 169
                 :.|:|....|.|:|.|.||::| :|: |:....:.|......|.....|.:|.||.:.:.
  Fly   145 -----FNLQIRDALPTDAGDYICQIATMDPREITHTVEILVPPRIHHISTGGHLQVKKGSSVRIE 204

  Fly   170 CLAMQSPVPPSFIYWYKGKRVMNYSQRGGINVITERSTRTSKLLIAKATPADSGNYTCS------ 228
            |.|..:|:|.           :.:|::..|....|....:..|.|........|.|.|:      
  Fly   205 CSATGNPMPN-----------VTWSRKNNILPNGEEKLHSHVLSIENVDRHKGGVYICTANNRVG 258

  Fly   229 -PSSSDSASVVVHV-----INGEHPAAMQHGNSSATCLRPLSSTSVPFVLATWMSMTV 280
             |:||   .||:||     |:.|.|.........||.:..:...:.|.|:  |...|:
  Fly   259 QPASS---QVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHGETQPEVI--WFKDTM 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 28/95 (29%)
IG_like 53..145 CDD:214653 28/94 (30%)
ig 153..227 CDD:278476 15/73 (21%)
IG_like 161..>227 CDD:214653 14/65 (22%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 27/86 (31%)
Ig 103..177 CDD:143165 26/80 (33%)
IG_like 191..269 CDD:214653 21/91 (23%)
IGc2 198..258 CDD:197706 14/70 (20%)
I-set 273..360 CDD:254352 9/41 (22%)
Ig 290..359 CDD:143165 6/24 (25%)
FN3 <466..524 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.