DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and igsf9ba

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_009289969.2 Gene:igsf9ba / 567389 ZFINID:ZDB-GENE-060503-729 Length:1475 Species:Danio rerio


Alignment Length:288 Identity:62/288 - (21%)
Similarity:103/288 - (35%) Gaps:81/288 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PPHYWETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTND 98
            ||.:.:||   |.:       |.|..|.:..|.|.........|:|:|:.|         ..|:.
Zfish   138 PPTFSDTP---PQY-------VEAREGGSITLTCTAFGNPKPVVTWLREGD---------QLTST 183

  Fly    99 QRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVVSRAKILG-------NA 156
            :::..  |:||    |.:.:....|.|.|.|:..::    ||..|:  .:|..:.|       ..
Zfish   184 RKYTV--SDGS----LTVQAITREDRGAYSCRAHSD----QGEALH--TTRLLVQGPPYIVTPPE 236

  Fly   157 ELFIKSGSDINLTCLAMQSPVPPSFI-YWYKGKRVMNYSQRGGINVITERSTRTSKLLIAKATPA 220
            .:.:....:...||.|...|...::. ||.:.........:..:.:..:     ..|:|.:..|.
Zfish   237 NITVNISQNAQFTCQAEAYPGNLTYTWYWEEDNVYFKNDLKLRVRIFID-----GTLIIYRVKPE 296

  Fly   221 DSGNYTCSPSS----SDSASVVVHVINGEHPAAMQH--------------------GNSSATCLR 261
            |:|.||||||:    |.|||..:.|   ::||.:.:                    .|...|.:|
Zfish   297 DAGKYTCSPSNSLGISPSASAYLTV---QYPARVVNMPPVIYVPRKLSGIIRCPVDANPPVTSVR 358

  Fly   262 ------PLSSTSVPFVLATWMSMTVASV 283
                  ||.....|    .|..||..|:
Zfish   359 WEKDGYPLRIEKYP----GWSQMTDGSI 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 21/92 (23%)
IG_like 53..145 CDD:214653 21/91 (23%)
ig 153..227 CDD:278476 13/81 (16%)
IG_like 161..>227 CDD:214653 12/66 (18%)
igsf9baXP_009289969.2 IG 30..115 CDD:214652
I-set 139..225 CDD:254352 26/116 (22%)
I-set 229..321 CDD:333254 21/96 (22%)
Ig 345..415 CDD:325142 10/42 (24%)
Ig 438..503 CDD:319273
FN3 511..606 CDD:238020
FN3 622..706 CDD:238020
Atrophin-1 <924..1361 CDD:331285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.