DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and paplna

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_005169942.1 Gene:paplna / 562930 ZFINID:ZDB-GENE-070815-4 Length:1187 Species:Danio rerio


Alignment Length:242 Identity:63/242 - (26%)
Similarity:89/242 - (36%) Gaps:50/242 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ETPYSQPYFDNSSRR-------EVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYT 96
            |...||.|...||.|       .|.|..||.|.|.|.|     ..||.|....:|....|     
Zfish   932 EVDSSQSYTSQSSSRFNIDYSPLVEARAGQTAKLQCSV-----LPVSAIHAVTIHWSRAG----- 986

  Fly    97 NDQRFQSL-HSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQ-GFRLNVV----VSRAKILGN 155
              |...|| ||:.|| .||.|......|||.|.|.|:...|..: ..:|.|:    :::|.|   
Zfish   987 --QPLNSLRHSQHSD-GTLVIKQLTADDSGLYTCTVTDAQKFEERQVQLRVLGDLRITKAPI--- 1045

  Fly   156 AELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGGINVITE----RSTRTSKLLIAK 216
             ::.:..||...|.|:.             .|:.|.....|.|:.|..:    ..:....|::..
Zfish  1046 -DVDVVQGSTAQLACVV-------------TGENVNVGWSRNGVPVRPDGHRVHVSADGTLILNN 1096

  Fly   217 ATPADSGNYTCSP-SSSDSASVVVHVINGEHPAAMQHGN--SSATCL 260
            ....|.|.|||:. :.:.|.|....:...:.|.....|.  ||:.|:
Zfish  1097 VQSVDEGTYTCNAYTGTLSVSAAAEIRLAKTPQQDIDGGQFSSSDCV 1143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 32/101 (32%)
IG_like 53..145 CDD:214653 32/100 (32%)
ig 153..227 CDD:278476 13/77 (17%)
IG_like 161..>227 CDD:214653 13/69 (19%)
paplnaXP_005169942.1 TSP1 24..75 CDD:214559
ADAM_spacer1 181..293 CDD:310520
TSP1 303..356 CDD:214559
TSP1 388..442 CDD:214559
TSP1 449..498 CDD:214559
TSP1 504..557 CDD:214559
KU 720..771 CDD:238057
Ig_3 839..906 CDD:316449
IGc2 960..1022 CDD:197706 27/74 (36%)
I-set 1039..1121 CDD:333254 19/98 (19%)
PLAC 1142..1173 CDD:312271 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.