DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and robo4

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_689255.3 Gene:robo4 / 560765 ZFINID:ZDB-GENE-020809-1 Length:1134 Species:Danio rerio


Alignment Length:251 Identity:54/251 - (21%)
Similarity:98/251 - (39%) Gaps:53/251 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EVTATVGQAALLHCRVRNLG--DRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRI 116
            :|...:|:.|.::|. ..:|  :..|:|  ::|      |||..::::.:..|..:      |.|
Zfish   181 DVEVAIGEMATINCS-PPVGHPEPNVTW--RKD------GILINSSNEHYTELKGK------LII 230

  Fly   117 SSPQPRDSGTYECQVSTEPKI--SQGFRLNVVVSRAKILGNAELFIKSGSDINLTCLAMQSPVPP 179
            :..|..|||.|.|..|....:  |:..||:|:.....:....::.::.|......|.|...|:|.
Zfish   231 APAQKNDSGVYSCIASNMIGVRESRAARLSV
LAKPVLLRKPEDVSVQLGESAQFFCEADGDPMPS 295

  Fly   180 SFIYWYK-------GKRVMNYSQRGGINVITERSTRTSKLLIAKATPADSGNYTCSPSSSDSASV 237
              |.|.:       |:.::|...               .|.|...|..|.|.|:|:..:....||
Zfish   296 --IEWSREQGPLPNGRYLINPDH---------------SLQIHYVTAQDMGRYSCTVENKLGVSV 343

  Fly   238 VVHVINGEHPAAMQHGNSSATCLRPLSSTSVPFVLATWMSMTVASVAWNSNLNINW 293
            .        .|.:...::..|.||.|.. .:..:..:..::||.|.|.|.: .:.|
Zfish   344 A--------SAQLLVEDAGGTRLRDLHK-ELSALRVSLENVTVMSTASNMS-QVMW 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 24/95 (25%)
IG_like 53..145 CDD:214653 24/94 (26%)
ig 153..227 CDD:278476 15/80 (19%)
IG_like 161..>227 CDD:214653 15/72 (21%)
robo4XP_689255.3 Ig1_Robo 70..169 CDD:143317
I-set 71..168 CDD:254352
I-set 175..261 CDD:254352 24/94 (26%)
Ig2_Robo 177..261 CDD:143201 24/94 (26%)
I-set 265..350 CDD:254352 19/109 (17%)
Ig 282..350 CDD:299845 18/92 (20%)
FN3 373..448 CDD:214495 6/18 (33%)
FN3 472..560 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.