| Sequence 1: | NP_001014616.2 | Gene: | dpr4 / 3346160 | FlyBaseID: | FBgn0053512 | Length: | 323 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009297968.1 | Gene: | sdk1a / 558391 | ZFINID: | ZDB-GENE-081104-374 | Length: | 2245 | Species: | Danio rerio |
| Alignment Length: | 251 | Identity: | 69/251 - (27%) |
|---|---|---|---|
| Similarity: | 102/251 - (40%) | Gaps: | 32/251 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 31 GEVPPH-YWETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILT 94
Fly 95 YTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYEC-QVSTEPKISQGFRLNVVVSRAKILG-NAE 157
Fly 158 LFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGGINVITERSTRTSKLLIAKATPADS 222
Fly 223 GNYTC---SPSSSDSASVVVHVINGEH-PAAMQ---HGNSSATC----LRPLSSTS 267 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr4 | NP_001014616.2 | V-set | 53..146 | CDD:284989 | 28/93 (30%) |
| IG_like | 53..145 | CDD:214653 | 28/92 (30%) | ||
| ig | 153..227 | CDD:278476 | 17/74 (23%) | ||
| IG_like | 161..>227 | CDD:214653 | 17/65 (26%) | ||
| sdk1a | XP_009297968.1 | I-set | 125..208 | CDD:254352 | |
| Ig | 125..204 | CDD:299845 | |||
| IG_like | 222..302 | CDD:214653 | |||
| Ig | 236..287 | CDD:299845 | |||
| Ig_3 | 322..394 | CDD:290638 | |||
| I-set | 323..412 | CDD:254352 | |||
| I-set | 416..505 | CDD:254352 | 4/9 (44%) | ||
| Ig | 436..500 | CDD:299845 | 2/4 (50%) | ||
| I-set | 510..600 | CDD:254352 | 30/101 (30%) | ||
| Ig | 527..600 | CDD:299845 | 25/83 (30%) | ||
| I-set | 605..693 | CDD:254352 | 22/93 (24%) | ||
| Ig | 610..693 | CDD:299845 | 21/88 (24%) | ||
| FN3 | 697..788 | CDD:238020 | 8/31 (26%) | ||
| fn3 | 800..886 | CDD:278470 | |||
| FN3 | 901..997 | CDD:238020 | |||
| FN3 | 1002..1090 | CDD:238020 | |||
| FN3 | 1100..1196 | CDD:238020 | |||
| FN3 | 1206..1301 | CDD:238020 | |||
| FN3 | 1308..1397 | CDD:238020 | |||
| FN3 | 1408..1501 | CDD:238020 | |||
| FN3 | 1507..1602 | CDD:238020 | |||
| FN3 | 1616..1722 | CDD:238020 | |||
| FN3 | 1732..1825 | CDD:238020 | |||
| FN3 | 1830..1919 | CDD:238020 | |||
| FN3 | 1931..2021 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||