DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and igsf9a

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_005155702.1 Gene:igsf9a / 557459 ZFINID:ZDB-GENE-060503-288 Length:1619 Species:Danio rerio


Alignment Length:212 Identity:52/212 - (24%)
Similarity:86/212 - (40%) Gaps:33/212 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGS 109
            |....:|..||...||::..|.|..:......::|.:               :....:..|....
Zfish   136 PVLTETSPPEVEVFVGRSLTLKCAAQGNPRPTITWSK---------------DGAPIKPQHKVKM 185

  Fly   110 DEWTLRISSPQPRDSGTYECQVS-TEPKISQGFRLNVVVSRAKILGNAELFIKSGSDINLTCLAM 173
            ...::...:.....:|.|:|..| :|...:...||.::.....|:..::..:....|..|.|.|.
Zfish   186 VNGSVSFHAVSREAAGQYQCYTSNSEGNATHVTRLKIIGPPVIIIPPSDTVLNMSQDAKLKCQAE 250

  Fly   174 QSPVPPSFIYWYKGKRVMNY---SQRGGINVITERSTRTSKLLIAKATPADSGNYTCSPSS---- 231
            ..  ||:..|.::.:.|..|   |.:..|.||.:     ..|||::..|.|||||||.|::    
Zfish   251 AD--PPNMTYVWQRQGVDIYHIDSLKSRIKVIVD-----GTLLISRLAPEDSGNYTCMPTNGLPV 308

  Fly   232 SDSASVVVHVINGEHPA 248
            |.|||.|:.|   :|||
Zfish   309 SPSASAVLTV---QHPA 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 15/93 (16%)
IG_like 53..145 CDD:214653 15/92 (16%)
ig 153..227 CDD:278476 22/76 (29%)
IG_like 161..>227 CDD:214653 22/68 (32%)
igsf9aXP_005155702.1 IG_like 27..110 CDD:214653
Ig 35..111 CDD:299845
I-set 140..221 CDD:254352 15/95 (16%)
IGc2 151..212 CDD:197706 9/75 (12%)
Ig 233..318 CDD:299845 30/91 (33%)
I-set 233..318 CDD:254352 30/91 (33%)
Ig <349..402 CDD:299845
IG_like 423..502 CDD:214653
Ig 435..498 CDD:143165
FN3 507..602 CDD:238020
fn3 614..696 CDD:278470
PHA02666 1105..>1312 CDD:222914
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.