DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and zgc:112965

DIOPT Version :10

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001018542.1 Gene:zgc:112965 / 553735 ZFINID:ZDB-GENE-050522-10 Length:325 Species:Danio rerio


Alignment Length:292 Identity:63/292 - (21%)
Similarity:108/292 - (36%) Gaps:74/292 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VTATVGQAALLHCRVRN---LGDRAVSWIRKRDLHILTVGILTYTNDQ-----RFQSLHSEG--- 108
            ::|.:|.:.:|.|.|..   :.|..|.| |:.|...|   :..|.:.:     :.|..|...   
Zfish    39 LSAPLGASVVLPCYVDEALPVEDLEVEW-RRADSETL---VHLYQDGESRAEVQQQDYHDRAHFF 99

  Fly   109 SDE-----WTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVV----VSRAKILG-NAELFIKSG 163
            ::|     ::||:.:...:|.|.|.|:|.::    |.....|:    |.|..:.| |..:.|..|
Zfish   100 TEEIQHGNFSLRLDNLTAQDEGEYRCRVHSQ----QDSEETVIKIK
DVERLLVSGTNRSVSIHVG 160

  Fly   164 SDINLTCLAMQSPVPPSFI---YWYKGKR-----VMNYSQ------------RGGINVITERSTR 208
            .|:.|.| ::.|.:.|..|   .|.|..:     ::.|..            ||.:...|....:
Zfish   161 EDVTLNC-SVDSHITPEHIEEVLWRKTDKDGDILILLYQNNKTVPEVGDEQFRGRVEFFTAEIPK 224

  Fly   209 TS-KLLIAKATPADSGNYTCSPSSSD-SASVVVHVINGEHPAAMQHGNSSATCLRPLSSTSVPFV 271
            .: .|.:......|.|.|.|...:.| ||:..  |:.|....:..|......|:....|..:|.|
Zfish   225 GNFSLKLKSVRTEDKGVYMCQVFAGDLSANAT--VVLGRLSFSALHTMVLILCISACGSALLPCV 287

  Fly   272 LATWMSMTVASVAWNSNLNINWNWSPD-WRWH 302
               |:                ::.||| .:||
Zfish   288 ---WI----------------YSRSPDKGQWH 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 IG_like 53..145 CDD:214653 23/105 (22%)
Ig strand A' 55..57 CDD:409355 0/1 (0%)
Ig strand B 61..69 CDD:409355 2/7 (29%)
CDR1 69..75 CDD:409355 1/8 (13%)
Ig strand C 76..82 CDD:409355 2/5 (40%)
CDR2 85..101 CDD:409355 2/20 (10%)
Ig strand D 101..106 CDD:409355 1/4 (25%)
FR3 102..131 CDD:409355 9/36 (25%)
Ig strand E 110..117 CDD:409355 3/11 (27%)
Ig strand F 125..132 CDD:409355 3/6 (50%)
IG_like 161..>227 CDD:214653 17/86 (20%)
Ig strand B 166..170 CDD:409353 1/3 (33%)
Ig strand C 181..185 CDD:409353 1/6 (17%)
Ig strand E 206..214 CDD:409353 1/8 (13%)
zgc:112965NP_001018542.1 Ig 32..141 CDD:472250 24/109 (22%)
Ig strand B 47..51 CDD:409353 1/3 (33%)
Ig strand C 63..67 CDD:409353 2/4 (50%)
Ig strand E 108..112 CDD:409353 1/3 (33%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 135..138 CDD:409353 0/2 (0%)
Ig 148..259 CDD:472250 25/113 (22%)
Ig strand B 163..167 CDD:409353 1/3 (33%)
Ig strand C 179..183 CDD:409353 0/3 (0%)
Ig strand E 227..231 CDD:409353 1/3 (33%)
Ig strand F 241..246 CDD:409353 2/4 (50%)
Ig strand G 254..257 CDD:409353 0/4 (0%)

Return to query results.
Submit another query.