DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and zgc:112965

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001018542.1 Gene:zgc:112965 / 553735 ZFINID:ZDB-GENE-050522-10 Length:325 Species:Danio rerio


Alignment Length:292 Identity:63/292 - (21%)
Similarity:108/292 - (36%) Gaps:74/292 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VTATVGQAALLHCRVRN---LGDRAVSWIRKRDLHILTVGILTYTNDQ-----RFQSLHSEG--- 108
            ::|.:|.:.:|.|.|..   :.|..|.| |:.|...|   :..|.:.:     :.|..|...   
Zfish    39 LSAPLGASVVLPCYVDEALPVEDLEVEW-RRADSETL---VHLYQDGESRAEVQQQDYHDRAHFF 99

  Fly   109 SDE-----WTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVV----VSRAKILG-NAELFIKSG 163
            ::|     ::||:.:...:|.|.|.|:|.::    |.....|:    |.|..:.| |..:.|..|
Zfish   100 TEEIQHGNFSLRLDNLTAQDEGEYRCRVHSQ----QDSEETVIKIK
DVERLLVSGTNRSVSIHVG 160

  Fly   164 SDINLTCLAMQSPVPPSFI---YWYKGKR-----VMNYSQ------------RGGINVITERSTR 208
            .|:.|.| ::.|.:.|..|   .|.|..:     ::.|..            ||.:...|....:
Zfish   161 EDVTLNC-SVDSHITPEHIEEVLWRKTDKDGDILILLYQNNKTVPEVGDEQFRGRVEFFTAEIPK 224

  Fly   209 TS-KLLIAKATPADSGNYTCSPSSSD-SASVVVHVINGEHPAAMQHGNSSATCLRPLSSTSVPFV 271
            .: .|.:......|.|.|.|...:.| ||:..  |:.|....:..|......|:....|..:|.|
Zfish   225 GNFSLKLKSVRTEDKGVYMCQVFAGDLSANAT--VVLGRLSFSALHTMVLILCISACGSALLPCV 287

  Fly   272 LATWMSMTVASVAWNSNLNINWNWSPD-WRWH 302
               |:                ::.||| .:||
Zfish   288 ---WI----------------YSRSPDKGQWH 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 23/106 (22%)
IG_like 53..145 CDD:214653 23/105 (22%)
ig 153..227 CDD:278476 20/95 (21%)
IG_like 161..>227 CDD:214653 17/86 (20%)
zgc:112965NP_001018542.1 IG_like 36..141 CDD:214653 24/109 (22%)
Ig 44..141 CDD:299845 23/104 (22%)
V-set 151..250 CDD:284989 20/99 (20%)
IG_like 153..257 CDD:214653 22/106 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.