DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and KIRREL1

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:289 Identity:71/289 - (24%)
Similarity:114/289 - (39%) Gaps:75/289 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LWLLLFLDCGMVGGEVPPHYWETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSWIRK 82
            :|:|...|....|       .:|.:||...|.      |...||.|:|.|.:.|..         
Human     6 VWILTLSDTFSQG-------TQTRFSQEPADQ------TVVAGQRAVLPCVLLNYS--------- 48

  Fly    83 RDLHILTVGILTYTND-------------QRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTE 134
                    ||:.:|.|             .|::.:.|..:.::.|.|:..:..|..:||||.:..
Human    49 --------GIVQWTKDGLALGMGQGLKAWPRYRVVGSADAGQYNLEITDAELSDDASYECQATEA 105

  Fly   135 PKISQGFRLNVVV--SRAKILGNAELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRG 197
            ...|:..:|.|::  ...:|.|...:.:::|:..||||.|..:. |.:.|.|::     :.:|:.
Human   106 ALRSRRAKLTVLIPPEDTRIDGGPVILLQAGTPHNLTCRAFNAK-PAATIIWFR-----DGTQQE 164

  Fly   198 GINVITE------RSTRTSKLLIAKATPADSGN-YTCS------PSSSD-SASVVVH----VING 244
            |....||      |.|..|:||| ..|..|.|. :||.      ||..: |..:.||    |...
Human   165 GAVASTELLKDGKRETTVSQLLI-NPTDLDIGRVFTCRSMNEAIPSGKETSIELDVHHPPTVTLS 228

  Fly   245 EHPAAMQHGNSSA-TCLRPLSSTSVPFVL 272
            ..|..:|.|.... ||    .:|:.|.:|
Human   229 IEPQTVQEGERVVFTC----QATANPEIL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 22/105 (21%)
IG_like 53..145 CDD:214653 22/104 (21%)
ig 153..227 CDD:278476 23/80 (29%)
IG_like 161..>227 CDD:214653 22/72 (31%)
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352 25/116 (22%)
Ig 25..116 CDD:299845 24/113 (21%)
Ig2_KIRREL3-like 138..219 CDD:143236 26/87 (30%)
I-set 223..304 CDD:254352 9/35 (26%)
Ig_2 227..305 CDD:290606 8/31 (26%)
Ig_2 311..405 CDD:290606
IG_like 314..405 CDD:214653
Ig5_KIRREL3 407..504 CDD:143306
IG_like 416..504 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.