DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and iglon5

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:317 Identity:63/317 - (19%)
Similarity:111/317 - (35%) Gaps:111/317 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VTATVGQAALLHCRVRNLGDRAV---SWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRI 116
            :|...|::.:|.|::    |..|   :|:.:.  :||..|...::.|.|. ||.:..:.::::||
Zfish    36 ITVLEGESVVLRCKI----DEEVTHKAWLNRS--NILFTGTDKWSLDSRV-SLENNNNSDFSIRI 93

  Fly   117 SSPQPRDSGTYEC--QVSTEPKISQGFRLNVVVSRAKILG-NAELFIKSGSDINLTCLAMQSP-- 176
            ......|.|.|.|  |...:|:.:..:.  :|...|:|:. :.:..:..|.|:||.|||:..|  
Zfish    94 ERVMVADEGPYTCSFQARNKPRTAHVYL--IV
QVPARIVNISQDKSVNEGEDVNLFCLAVGRPEP 156

  Fly   177 ----------------------------------------------------------------- 176
                                                                             
Zfish   157 TITWKDFKYGLLNEGEFLEITEIKRHQAEDFECITNNGVAPPDTRKVKVTVNYPPIITDVKNMPA 221

  Fly   177 --------------VPPSFIYWYKGKRVMNYSQRGGINVITERSTRT-SKLLIAKATPADSGNYT 226
                          ||.:...||:..|....|.    |.:..::.:| |.||....|....||||
Zfish   222 QVGKTAILRCEAMAVPTASFEWYRDDRRPVESD----NTLKIKNEKTRSLLLFTNVTEKHFGNYT 282

  Fly   227 CSPSS---SDSASVVVHVINGEHPAAMQHGNSSATCLRPLSSTSVPFVLATWMSMTV 280
            |..|:   :.:||:::.     .|.|:..|  :|:....||...:.|.|:..:.|.|
Zfish   283 CFASNRLGASNASMLLF-----RPGAVYGG--AASLNGRLSGVGLWFCLSISVLMKV 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 22/95 (23%)
IG_like 53..145 CDD:214653 22/94 (23%)
ig 153..227 CDD:278476 23/156 (15%)
IG_like 161..>227 CDD:214653 23/147 (16%)
iglon5NP_001017775.2 IG_like 33..123 CDD:214653 22/95 (23%)
Ig 35..123 CDD:299845 22/95 (23%)
Ig 125..>183 CDD:299845 10/57 (18%)
I-set 128..207 CDD:254352 9/78 (12%)
IG_like 217..298 CDD:214653 20/84 (24%)
ig 223..296 CDD:278476 19/76 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.