DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and dpr12

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:250 Identity:104/250 - (41%)
Similarity:143/250 - (57%) Gaps:13/250 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 WLLLFLDCGMVGGEVPPHYWETPYSQPYFDNSS--RREVTATVGQAALLHCRVRNLGDRA----- 76
            |..|::..|:.|.....:..::..| |.|::|.  ....|..:|..|.|.|:|..: ||.     
  Fly    50 WKKLWMRGGINGDSKLDNNLDSSDS-PMFEDSELMAHNTTVQLGGTAFLVCKVSGV-DRVGVNWN 112

  Fly    77 -VSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQG 140
             :||||:||.|||:.|...||||:||..||:.||:.|||:|...|.||.|.|||||||...|...
  Fly   113 QISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGIISH 177

  Fly   141 F-RLNVVVSRAKILGNAELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNY-SQRGGINVIT 203
            | .|.|||..|.|||:.||.:..||.|||.|:..:||.||.::||.|..|::|| ..|..|.:.|
  Fly   178 FVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIET 242

  Fly   204 ERSTRT-SKLLIAKATPADSGNYTCSPSSSDSASVVVHVINGEHPAAMQHGNSSA 257
            ....|| |:|:|.:....||||||||.|:::.||:.|.|..|::.||:....:|:
  Fly   243 TPGPRTQSRLIIREPQVTDSGNYTCSASNTEPASIYVFVSKGDNMAAISRRKTSS 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 46/99 (46%)
IG_like 53..145 CDD:214653 46/98 (47%)
ig 153..227 CDD:278476 33/75 (44%)
IG_like 161..>227 CDD:214653 29/67 (43%)
dpr12NP_652462.3 IG 86..183 CDD:214652 46/97 (47%)
Ig_3 193..271 CDD:404760 34/77 (44%)
Ig strand B 204..208 CDD:409353 3/3 (100%)
Ig strand C 219..223 CDD:409353 1/3 (33%)
Ig strand E 250..254 CDD:409353 2/3 (67%)
Ig strand F 264..269 CDD:409353 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.