DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and dpr6

DIOPT Version :10

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster


Alignment Length:227 Identity:124/227 - (54%)
Similarity:159/227 - (70%) Gaps:8/227 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YWETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRF 101
            |....:.:||||.|:.|.|||.:|::|.|.||||||.::.|||||.||:||||||..|||:||||
  Fly    65 YTHPKWMEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRF 129

  Fly   102 QSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVVSRAKILGNAELFIKSGSDI 166
            |:.|.:.:::|||:|...|.||:|.||||:||:|..|...||||||..|.|||..:|.:..||.|
  Fly   130 QATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILGGPDLHVDKGSTI 194

  Fly   167 NLTCLAMQSPVPPSFIYWYKGKRVMNY-SQRGGINVITER-STRTSKLLIAKATPADSGNYTCSP 229
            ||||....||.||::|:||..:.|:|| |.|||::||||: ...||.|||..|..||||.|:|:|
  Fly   195 NLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAP 259

  Fly   230 SSSDSASVVVHVIN------GEHPAAMQHGNS 255
            |::|.|||.|||:|      ||||.|||.|:|
  Fly   260 SNADVASVRVHVLNVRAIISGEHPEAMQTGSS 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 IG_like 53..145 CDD:214653 53/91 (58%)
Ig strand A' 55..57 CDD:409355 1/1 (100%)
Ig strand B 61..69 CDD:409355 3/7 (43%)
CDR1 69..75 CDD:409355 4/5 (80%)
Ig strand C 76..82 CDD:409355 4/5 (80%)
CDR2 85..101 CDD:409355 11/15 (73%)
Ig strand D 101..106 CDD:409355 2/4 (50%)
FR3 102..131 CDD:409355 13/28 (46%)
Ig strand E 110..117 CDD:409355 3/6 (50%)
Ig strand F 125..132 CDD:409355 5/6 (83%)
IG_like 161..>227 CDD:214653 36/67 (54%)
Ig strand B 166..170 CDD:409353 3/3 (100%)
Ig strand C 181..185 CDD:409353 1/3 (33%)
Ig strand E 206..214 CDD:409353 3/7 (43%)
dpr6NP_001287018.1 FR1 79..96 CDD:409355 7/16 (44%)
IG_like 80..175 CDD:214653 55/94 (59%)
Ig strand A' 83..85 CDD:409355 1/1 (100%)
Ig strand B 89..97 CDD:409355 3/7 (43%)
CDR1 97..104 CDD:409355 4/6 (67%)
FR2 105..114 CDD:409355 7/8 (88%)
Ig strand C 105..110 CDD:409355 4/4 (100%)
CDR2 115..129 CDD:409355 10/13 (77%)
Ig strand D 129..135 CDD:409355 3/5 (60%)
FR3 130..159 CDD:409355 13/28 (46%)
Ig strand E 139..145 CDD:409355 3/5 (60%)
Ig strand F 153..160 CDD:409355 5/6 (83%)
IG_like 184..271 CDD:214653 45/86 (52%)
Ig strand B 194..198 CDD:409353 3/3 (100%)
Ig strand C 209..213 CDD:409353 1/3 (33%)
Ig strand E 240..244 CDD:409353 2/3 (67%)
Ig strand F 254..259 CDD:409353 2/4 (50%)
Ig strand G 268..271 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.