DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and NCAM1

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens


Alignment Length:389 Identity:73/389 - (18%)
Similarity:131/389 - (33%) Gaps:123/389 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LWLLLFLDCGM-VGGEVPPHYWETPYSQPYFDNSSRREVTATVGQAALLHCRVR-NLGDRAVSWI 80
            :|.|.||...: :..::.|               |:.|:  :||::....|:|. :..|:.:||.
Human     8 IWTLFFLGTAVSLQVDIVP---------------SQGEI--SVGESKFFLCQVAGDAKDKDISWF 55

  Fly    81 RKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNV 145
            ...       |.....|.||...:.::.|.. ||.|.:....|:|.|:|.|:.|........:||
Human    56 SPN-------GEKLTPNQQRISVVWNDDSSS-TLTIYNANIDDAGIYKCVVTGEDGSESEATVNV 112

  Fly   146 VVSRAKILGNAEL--FIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVM------------NYSQR 196
            .:.:..:..||..  ..:.|.|..:.|..:.| :||:.|:.:||:.|:            ||.|.
Human   113 KIFQKLMFKNAPTPQEFREGEDAVIVCDVVSS-LPPTIIWKHKGRDVILKKDVRFIVLSNNYLQI 176

  Fly   197 GGINVITERSTRTSKLLIAK----------------------------ATPADSGNYTCSPS--- 230
            .||....|.:.|....::|:                            |....|....|...   
Human   177 RGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFP 241

  Fly   231 ------------------------SSDSASVVVHVINGEHPAAM------QHGNSSATC-LRPLS 264
                                    |.||:.:.:..::....|..      :.|...||. |:..:
Human   242 EPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFA 306

  Fly   265 STSVPFV-------LATWMSMT-------VASVAW-NSNLNIN----WNWSPDWRWHWNPKWNW 309
            ...:.:|       |...:::|       :.|:.| .|..||:    .:|:...:...:..|||
Human   307 KPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQEVHAPWNW 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 23/93 (25%)
IG_like 53..145 CDD:214653 22/92 (24%)
ig 153..227 CDD:278476 22/115 (19%)
IG_like 161..>227 CDD:214653 20/105 (19%)
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273 26/119 (22%)
IG 124..190 CDD:214652 17/66 (26%)
Ig 211..307 CDD:325142 11/95 (12%)
Ig 306..438 CDD:325142 12/65 (18%)
Ig_3 447..519 CDD:316449
FN3 534..631 CDD:238020
fn3 639..720 CDD:306538
Trypan_PARP <792..>864 CDD:330686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.