DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and tutl

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster


Alignment Length:266 Identity:61/266 - (22%)
Similarity:97/266 - (36%) Gaps:51/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVG--ILTYTNDQRFQSLHSEGSDEWTLRIS 117
            :||.:|:..:.:|.|....|..|.::.:.|..:...|  :..|...:.:.....||......|:|
  Fly   138 ITAILGEGVIFNCHVEFPNDHPVPYVLQWDKKVSETGSDLPIYIWYESYPEHIEEGYKGRVSRVS 202

  Fly   118 SPQP-------------RDSGTYECQV---STEPKISQG---FRLNV-VVSRAKILGNAELFIKS 162
            ...|             .|.|.|||:|   :.:||..:.   |.|:| ...|..:.....:::..
  Fly   203 QDSPFGSASLNLTNIRESDQGWYECKVVFLNRDPKQHKNGTWFHLDVH
APPRFSVTPEDIIYVNL 267

  Fly   163 GSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGGI-NVITERSTRTSKLLIAKATPADSGNYT 226
            |..|.|.|.|..:|.|.  |.|||....::.|...|| |..||       |.|:.....|.|.||
  Fly   268 GDSIILNCQADGTPTPE--ILWYKDANPVDPSPTVGIFNDGTE-------LRISTIRHEDIGEYT 323

  Fly   227 CSPSSSDSASVVVHVINGE----HPAAMQHGNSSATCLRPLSSTSVPFVLATWMSMTVASVAWNS 287
            |...            |||    |.|.:.....:...:.|.:.|.:.   ...:..:..:.|...
  Fly   324 CIAR------------NGEGQVSHTARVIIAGGAVIMVPPTNQTKLE---GEKVIFSCEAKAMPG 373

  Fly   288 NLNINW 293
            |:.:.|
  Fly   374 NVTVRW 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 26/112 (23%)
IG_like 53..145 CDD:214653 25/110 (23%)
ig 153..227 CDD:278476 22/74 (30%)
IG_like 161..>227 CDD:214653 22/66 (33%)
tutlNP_001303307.1 V-set 137..250 CDD:284989 25/111 (23%)
IG_like 137..229 CDD:214653 20/90 (22%)
I-set 253..341 CDD:254352 30/108 (28%)
IGc2 268..331 CDD:197706 26/83 (31%)
I-set 346..437 CDD:254352 5/37 (14%)
Ig 349..437 CDD:299845 5/34 (15%)
Ig 459..530 CDD:299845
IG_like 549..628 CDD:214653
IGc2 551..617 CDD:197706
FN3 633..725 CDD:238020
FN3 786..874 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.