DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and opcml

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:281 Identity:70/281 - (24%)
Similarity:120/281 - (42%) Gaps:60/281 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CLVPLWL-LLFLDCGMVGGEVPPHYWETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGDRAV 77
            |||.:.| ||||    |...||....         |:..:..:|...|.:|:|.|.:.|...| |
Zfish    13 CLVVVALRLLFL----VPAGVPARSG---------DSYLKDNITVRQGDSAVLKCSMDNKVSR-V 63

  Fly    78 SWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFR 142
            :|:.:..  ||..|...::.|.|...|:: ..:|::::|.:....|.|.|.|.:.|..| .:..:
Zfish    64 AWLNRTT--ILFTGNEKWSLDPRVVLLNT-AVNEYSIKILNVNLYDEGPYVCSILTNKK-PESTK 124

  Fly   143 LNVVVS-RAKILG-NAELFIKSGSDINLTCLAMQSPVPPSFIYW----YKGKRVM---NYSQRGG 198
            ::::|. .|:|:. :.::.:..||:::|.|||:..|.|.  |.|    .||.|::   .|.:..|
Zfish   125 VHLIVQVPARIVNVSTDVSVNEGSNVSLMCLAIGRPEPS--ILWKFRSSKGNRIVTEGEYVEMTG 187

  Fly   199 INVITERSTRTSKLLIAKATPADSGNYTCSPSSS----DSASVVVHVINGEHPAAMQHGNSSATC 259
            |                  |...||:|.|..|:.    |..:|.|.|   .:|..:....|:.|.
Zfish   188 I------------------TKDMSGSYDCITSNDISPPDVRTVQVTV---NYPPVISRARSTGTA 231

  Fly   260 LRP-----LSSTSVPFVLATW 275
            :..     ..:::||.....|
Zfish   232 VGQKGVLWCEASAVPLADFQW 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 23/92 (25%)
IG_like 53..145 CDD:214653 23/91 (25%)
ig 153..227 CDD:278476 20/81 (25%)
IG_like 161..>227 CDD:214653 20/72 (28%)
opcmlNP_001005580.1 Ig 41..129 CDD:299845 23/92 (25%)
IG_like 41..129 CDD:214653 23/92 (25%)
IG_like 139..216 CDD:214653 25/96 (26%)
IGc2 146..202 CDD:197706 21/75 (28%)
I-set 219..307 CDD:254352 6/34 (18%)
ig 223..307 CDD:278476 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.