DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and DIP-gamma

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:411 Identity:87/411 - (21%)
Similarity:131/411 - (31%) Gaps:165/411 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLLFLDCGMVGGEVPPHYWETPYSQP------YFDNSSRREVTATVGQAALLHCRVRNLGDRAVS 78
            |::...||. |.....|:..:....|      :.:|     ||...|:.|:|.|.|||||...|.
  Fly    13 LIMATKCGS-GSTQNQHHESSSQLDPDPEFIGFINN-----VTYPAGREAILACSVRNLGKNKVG 71

  Fly    79 WIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRL 143
            |:|..|..:|.:.....|::.|...:|.: ...|.|:||..:..|.|.|.||::|.|...|...:
  Fly    72 WLRASDQTVLALQGRVVTHNARISVMHQD-MHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCI 135

  Fly   144 NVVVSRAKI--LGNAELFIKSGSDINLTCLAMQSP------------------------------ 176
            :|.|....|  ..:|:|.::.|.|..|||.|..:|                              
  Fly   136 DVQVPPDIINEESSADLAVQEGEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESY 200

  Fly   177 -------------------------VPPS------------------------------------ 180
                                     |||:                                    
  Fly   201 NGSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQV 265

  Fly   181 ------FIYWYKGKRVMNYSQRGGINV----------------------ITER--STRTSKLLIA 215
                  ..||.||.|..|    |..:|                      ||||  ..|...||:.
  Fly   266 EASPSPVSYWLKGARTSN----GFASVSTASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVV 326

  Fly   216 KA-TPADSGNYTC--------------------SPSSSDSASVVVHVINGEHPAAMQHGNSSATC 259
            :: :|:|.|.|.|                    .|.:|.|....::.|.|...||...|.|:.|.
  Fly   327 RSFSPSDVGTYHCVSTNSLGRAEGTLRLYEIKLHPGASASNDDHLNYIGGLEEAARNAGRSNRTT 391

  Fly   260 LRPLSSTSVPFVLATWMSMTV 280
            .:||    :..::..||.:::
  Fly   392 WQPL----LAMLMLLWMRLSL 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 31/92 (34%)
IG_like 53..145 CDD:214653 31/91 (34%)
ig 153..227 CDD:278476 31/195 (16%)
IG_like 161..>227 CDD:214653 29/187 (16%)
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 33/97 (34%)
Ig 47..129 CDD:299845 31/87 (36%)
Ig 140..238 CDD:299845 13/97 (13%)
IG_like 247..355 CDD:214653 20/111 (18%)
Ig 256..351 CDD:299845 20/98 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12439
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.