DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and klg

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster


Alignment Length:235 Identity:65/235 - (27%)
Similarity:102/235 - (43%) Gaps:25/235 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQP 121
            |.||...:|.|:|.|||:..:.|  :|..::||...:..|.|:|.:.:     |.:.|.||..:|
  Fly   112 AVVGDTLVLPCQVENLGNFVLLW--RRGTNVLTASNIMVTRDERVRLI-----DGYNLEISDLEP 169

  Fly   122 RDSGTYECQVSTEPKISQGFRLNVVV--SRAKILGNAELFIKSGSDINLTCLAMQSPVPPSFIYW 184
            :|:|.|.||:|.:....|...:.::|  |...|..:.:|..:.|..|.|.|....:|||.  |||
  Fly   170 QDAGDYVCQISDKINRDQVHTVEILV
PPSVRAIPTSGQLQARKGGPITLECKGSGNPVPS--IYW 232

  Fly   185 YKGKRVMNYSQRGGINVITERSTRTSKLLIAKATPADSGNYTCSPSSSDSASVVVHV-INGEHPA 248
            .|         :.|.|..|.|......|.:.|.....:|.|.|:..:.....|.|.: ::..:|.
  Fly   233 TK---------KSGANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPP 288

  Fly   249 AMQHGNSSATCLRPLSSTSVPFVLATWMSMTVASVAWNSN 288
            .:|...|.........:..|..|.|.    .||:|:|..|
  Fly   289 DIQVEKSWIHSGEGFEAKLVCIVFAD----PVATVSWYQN 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 28/88 (32%)
IG_like 53..145 CDD:214653 28/87 (32%)
ig 153..227 CDD:278476 20/73 (27%)
IG_like 161..>227 CDD:214653 19/65 (29%)
klgNP_524454.2 DUF1370 63..>124 CDD:284518 5/11 (45%)
IG_like 109..195 CDD:214653 28/89 (31%)
Ig 118..191 CDD:143165 25/79 (32%)
IG_like 205..274 CDD:214653 21/79 (27%)
IGc2 213..273 CDD:197706 20/70 (29%)
IGc2 301..367 CDD:197706 8/28 (29%)
FN3 392..486 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.