DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and dpr15

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster


Alignment Length:379 Identity:91/379 - (24%)
Similarity:132/379 - (34%) Gaps:173/379 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSP 119
            :.:..|..|.|.|.|:.|..:.:||:|.||.|||||...|:..||||||:.|...:.|:|:|...
  Fly   199 IISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYV 263

  Fly   120 QPRDSGTYECQVSTEPKISQGFRLNVVVSRAKILGNAELFIKSGSDINLTCLAMQSPVPPSFIYW 184
            |.:|.||||||||||||.|....|.:|..:.:::|.:...:|:||.:.|.|:..|:..||.||.|
  Fly   264 QLKDEGTYECQVSTEPKASAIVHLRIV
EPKTELIGESTRHVKAGSQVKLRCIISQALEPPLFINW 328

  Fly   185 -YKGKRVMNYSQRG--------------------------------------------------- 197
             |..|::..:::||                                                   
  Fly   329 FYNQKQIYLHNRRGWRTEIERIDLPAEVPTTSTTTTTTTTTASTTTTTTSTTPATPSTTATGSTE 393

  Fly   198 -----------------------------------GINVITERST-------------------- 207
                                               |:.|.||.||                    
  Fly   394 GATSSETLNGLVTITRSYILDAISQNDVSELGAAAGVAVATETSTAQLLTEVEATSSTSGTSTGA 458

  Fly   208 ----------------------------------------------------------------- 207
                                                                             
  Fly   459 GLLASTSAAYAAGAAAGITTAATGDSAATAATTSAWLTTMDAEAATTAATTTTTMLPSSSFIKQI 523

  Fly   208 RTSKLLIAKATPADSGNYTCSPSSSDSASVVVHVINGEHPA-AMQHGNSSATCL 260
            .|:.|:|......||||||||||:|...::|:||:|||:.| |::.|:.|.:.|
  Fly   524 TTASLIIPAVVKLDSGNYTCSPSNSAPRTIVLHVLNGEYSASAIKSGSVSWSAL 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 43/90 (48%)
IG_like 53..145 CDD:214653 43/89 (48%)
ig 153..227 CDD:278476 30/245 (12%)
IG_like 161..>227 CDD:214653 29/237 (12%)
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 43/89 (48%)
V-set 204..290 CDD:284989 43/85 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444713
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.