DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and dpr17

DIOPT Version :10

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_731670.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:206 Identity:76/206 - (36%)
Similarity:123/206 - (59%) Gaps:11/206 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSD-EWTLRISS 118
            :||.:|..|.:.|::..|.|:.|||:|.||.||::|...|:..|:||||::.|..| .|:|:|..
  Fly   415 ITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIKY 479

  Fly   119 PQPRDSGTYECQVSTEPKISQGFRLNVVVSRAKILGNAELFIKSGSDINLTCLAMQSPVPPSFIY 183
            .:|.|:|.||||::||||:|....|.:|..:.:::|:...|:|:||.:.|.|:...:..||.:|.
  Fly   480 VEPSDAGWYECQMATEPKLSAKVHLQIVKPKTELIGDQSRFVKAGSKVALHCIVRGTLDPPKYII 544

  Fly   184 WYKG-KRVMNYSQRGG---------INVITERSTRTSKLLIAKATPADSGNYTCSPSSSDSASVV 238
            |::| |::.:..:|.|         ...:.:.......|:|......|||||||.||:|.|.||.
  Fly   545 WFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQPSNSVSVSVD 609

  Fly   239 VHVINGEHPAA 249
            :||::||:.|:
  Fly   610 LHVLSGEYSAS 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 IG_like 53..145 CDD:214653 40/90 (44%)
Ig strand A' 55..57 CDD:409355 0/1 (0%)
Ig strand B 61..69 CDD:409355 2/7 (29%)
CDR1 69..75 CDD:409355 1/5 (20%)
Ig strand C 76..82 CDD:409355 3/5 (60%)
CDR2 85..101 CDD:409355 5/15 (33%)
Ig strand D 101..106 CDD:409355 3/4 (75%)
FR3 102..131 CDD:409355 13/29 (45%)
Ig strand E 110..117 CDD:409355 3/7 (43%)
Ig strand F 125..132 CDD:409355 5/6 (83%)
IG_like 161..>227 CDD:214653 20/75 (27%)
Ig strand B 166..170 CDD:409353 1/3 (33%)
Ig strand C 181..185 CDD:409353 1/3 (33%)
Ig strand E 206..214 CDD:409353 1/7 (14%)
dpr17NP_731670.1 V-set 415..507 CDD:462230 40/91 (44%)
IG_like 521..612 CDD:214653 28/90 (31%)
Ig strand B 527..531 CDD:409353 1/3 (33%)
Ig strand C 542..546 CDD:409353 1/3 (33%)
Ig strand E 581..585 CDD:409353 1/3 (33%)
Ig strand F 595..600 CDD:409353 4/4 (100%)

Return to query results.
Submit another query.