DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and dpr11

DIOPT Version :10

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster


Alignment Length:253 Identity:99/253 - (39%)
Similarity:143/253 - (56%) Gaps:25/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEG 108
            :||.|..:...||..:|..|.|.|||:.||:::|||||.||.|||||....:..||||.:: .:.
  Fly   116 EPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAI-KQP 179

  Fly   109 SDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVVSRAKILGNAELFIKSGSDINLTCLAM 173
            ...|||:|...|.||:|:||||||||||:|...:|.|||.|.:|||..:.::|:||::.|.|:..
  Fly   180 DKYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVPRTEILGEPDRYVKAGSNVVLRCIVR 244

  Fly   174 QSPVPPSFIYWYKGKRVM-------------NYSQRGGINVITERSTRTSKLLIAKATPADSGNY 225
            .:..||:||.||.|...:             |..:..|     |..:....|:|..|...|:|||
  Fly   245 GALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASG-----EGQSTIGSLIIESAKKRDTGNY 304

  Fly   226 TCSPSSSDSASVVVHVINGEHPAAMQHGNSSATCLRPLSSTSVPFVLATWMSMTVASV 283
            |||||:|.||:|.:::||||..|:....:::.|....||      :||..:|:.:..|
  Fly   305 TCSPSNSPSATVTLNIINGESSASAVTSSAATTRAYALS------ILALLLSVILIGV 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 IG_like 53..145 CDD:214653 46/91 (51%)
Ig strand A' 55..57 CDD:409355 1/1 (100%)
Ig strand B 61..69 CDD:409355 3/7 (43%)
CDR1 69..75 CDD:409355 3/5 (60%)
Ig strand C 76..82 CDD:409355 4/5 (80%)
CDR2 85..101 CDD:409355 7/15 (47%)
Ig strand D 101..106 CDD:409355 1/4 (25%)
FR3 102..131 CDD:409355 11/28 (39%)
Ig strand E 110..117 CDD:409355 3/6 (50%)
Ig strand F 125..132 CDD:409355 5/6 (83%)
IG_like 161..>227 CDD:214653 22/78 (28%)
Ig strand B 166..170 CDD:409353 1/3 (33%)
Ig strand C 181..185 CDD:409353 2/3 (67%)
Ig strand E 206..214 CDD:409353 1/7 (14%)
dpr11NP_788586.1 Ig 125..216 CDD:472250 46/91 (51%)
Ig strand B 135..139 CDD:409353 2/3 (67%)
Ig strand C 148..152 CDD:409353 2/3 (67%)
Ig strand E 183..187 CDD:409353 3/3 (100%)
Ig strand F 197..202 CDD:409353 3/4 (75%)
IG_like 227..320 CDD:214653 31/97 (32%)
Ig strand B 237..241 CDD:409544 1/3 (33%)
Ig strand C 252..256 CDD:409544 2/3 (67%)
Ig strand E 289..293 CDD:409544 1/3 (33%)
Ig strand G 313..316 CDD:409544 2/2 (100%)

Return to query results.
Submit another query.