Sequence 1: | NP_001014616.2 | Gene: | dpr4 / 3346160 | FlyBaseID: | FBgn0053512 | Length: | 323 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001287169.1 | Gene: | dpr16 / 40619 | FlyBaseID: | FBgn0037295 | Length: | 488 | Species: | Drosophila melanogaster |
Alignment Length: | 271 | Identity: | 84/271 - (30%) |
---|---|---|---|
Similarity: | 131/271 - (48%) | Gaps: | 64/271 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 RREVT-----ATV--GQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSL----- 104
Fly 105 -------------------------HS-EGSDE--------WTLRISSPQPRDSGTYECQVSTEP 135
Fly 136 KISQGFRLNVVVSRAKILGNAELFIKSGSDINLTCLAMQSPVPPSFIYWYKG-KRVMNYSQRGGI 199
Fly 200 ----------NVI--TERSTRT-SKLLIAKATPADSGNYTCSPSSSDSASVVVHVINGEHPAAMQ 251
Fly 252 HGNSSATCLRP 262 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr4 | NP_001014616.2 | V-set | 53..146 | CDD:284989 | 43/138 (31%) |
IG_like | 53..145 | CDD:214653 | 43/137 (31%) | ||
ig | 153..227 | CDD:278476 | 24/87 (28%) | ||
IG_like | 161..>227 | CDD:214653 | 22/79 (28%) | ||
dpr16 | NP_001287169.1 | IG_like | 205..337 | CDD:214653 | 42/131 (32%) |
Ig | <298..338 | CDD:299845 | 16/39 (41%) | ||
IG_like | 352..447 | CDD:214653 | 28/94 (30%) | ||
Ig | 358..439 | CDD:143165 | 22/80 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45444709 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 82 | 1.000 | Inparanoid score | I5030 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000207 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23279 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.890 |