DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and dpr16

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:271 Identity:84/271 - (30%)
Similarity:131/271 - (48%) Gaps:64/271 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RREVT-----ATV--GQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSL----- 104
            ||:::     |||  ||.|.|.|::.....:.:||:|.||.||:.|...|:.||.||.||     
  Fly   198 RRQLSLPPLNATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTT 262

  Fly   105 -------------------------HS-EGSDE--------WTLRISSPQPRDSGTYECQVSTEP 135
                                     |: .|..|        |||:|......|:|.||||::|||
  Fly   263 LTTLVSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATEP 327

  Fly   136 KISQGFRLNVVVSRAKILGNAELFIKSGSDINLTCLAMQSPVPPSFIYWYKG-KRVMNYSQRGGI 199
            |:|...:|.|:..|.:::|:.:.|:|:||.:.|.|:...:...|.:|:||:| ::|...::..|.
  Fly   328 KMSAKVQLFVITPRTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEASGA 392

  Fly   200 ----------NVI--TERSTRT-SKLLIAKATPADSGNYTCSPSSSDSASVVVHVINGEHPAAMQ 251
                      |:.  ||.:..| ..|:|.......||||||.|.:|.:||:.:||::||:.|:. 
  Fly   393 QSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAAASMQLHVLSGEYSASA- 456

  Fly   252 HGNSSATCLRP 262
               ..:|..||
  Fly   457 ---IKSTAARP 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 43/138 (31%)
IG_like 53..145 CDD:214653 43/137 (31%)
ig 153..227 CDD:278476 24/87 (28%)
IG_like 161..>227 CDD:214653 22/79 (28%)
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 42/131 (32%)
Ig <298..338 CDD:299845 16/39 (41%)
IG_like 352..447 CDD:214653 28/94 (30%)
Ig 358..439 CDD:143165 22/80 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444709
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5030
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.