DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and LSAMP

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:336 Identity:82/336 - (24%)
Similarity:134/336 - (39%) Gaps:74/336 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KAICLVPLWLLLFLDCGMVGGEVPPHYWETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGDR 75
            |.:.||.|.||..|..|:            |.....| |.....:|...|..|:|.|.|.:...:
Human    10 KQLPLVLLRLLCLLPTGL------------PVRSVDF-NRGTDNITVRQGDTAILRCVVEDKNSK 61

  Fly    76 AVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVST--EPKIS 138
             |:|:.:..  |:..|...::.|.|.: |....|.|::|||......|.|:|.|.|.|  |||.|
Human    62 -VAWLNRSG--IIFAGHDKWSLDPRVE-LEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTS 122

  Fly   139 QGFRLNVVVSRAKILGNAELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGGINVIT 203
            |.:.:..|..:...: ::::.:..||::.|.|:|...|.|                      |||
Human   123 QVYLIVQVPPKISNI-SSDVTVNEGSNVTLVCMANGRPEP----------------------VIT 164

  Fly   204 ERS-TRTSK--------LLIAKATPADSGNYTCSPSSSDSASVVVHV-INGEHPAAMQHGNSS-A 257
            .|. |.|.:        |.|...|...||.|.|..::..|::.|..| :...:|..:....|: |
Human   165 WRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEA 229

  Fly   258 TCLRPLS----STSVPFVLATWM----------SMTVASVAWNSNLNINWNWSPDWRWHWNPKWN 308
            |..|..|    :::||.....|.          .:.:.|....|:|.:. |.:.:   |:.   |
Human   230 TTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVT-NVTEE---HYG---N 287

  Fly   309 WSNLAAGLVGI 319
            ::.:||..:|:
Human   288 YTCVAANKLGV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 29/94 (31%)
IG_like 53..145 CDD:214653 29/93 (31%)
ig 153..227 CDD:278476 19/82 (23%)
IG_like 161..>227 CDD:214653 19/74 (26%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 29/93 (31%)
Ig 132..215 CDD:386229 23/105 (22%)
Ig_3 219..294 CDD:372822 15/81 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.