DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and dpr10

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:349 Identity:121/349 - (34%)
Similarity:164/349 - (46%) Gaps:97/349 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVPLWLLLFLDCGMVGGEV-----------------------PPHY-----WETPYSQPYFDNSS 51
            ::.||..||  |.:.|..|                       |.||     |    ::||||.:.
  Fly     1 MLTLWTALF--CCLTGLAVCYQRQSVSNNNHNNAEAKPTHAPPSHYPHGHKW----NEPYFDLTM 59

  Fly    52 RREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRI 116
            .|.:|:.||::|.|.|||::||::.|:|||.|||||||||..|||.|||||:.:....|||||:|
  Fly    60 PRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQI 124

  Fly   117 SSPQPRDSGTYECQVSTEPKISQGFRLNVV----------------------------------- 146
            ...|.||:|.||||:||:|..|....||:|                                   
  Fly   125 KWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEF 189

  Fly   147 -----------VSRAKILGNAELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGG-I 199
                       |..|.|||..:|::..||.|||||:...||.||:.|:||...:|::....|| :
  Fly   190 AGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRL 254

  Fly   200 NVITERSTRT-SKLLIAKATPADSGNYTCSPSSSDSASVVVHVINGEHPAAMQ------------ 251
            ...|.:|..| |.|||..|....||.|:|.||:::.||:.|||:.||.|.|||            
  Fly   255 KFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQTNAAPAAVALAC 319

  Fly   252 ---HGNSSATCLRPLSSTSVPFVL 272
               |...:...:|.:|:.....||
  Fly   320 WSCHFGQATQAVRVISTMVAALVL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 52/92 (57%)
IG_like 53..145 CDD:214653 51/91 (56%)
ig 153..227 CDD:278476 31/75 (41%)
IG_like 161..>227 CDD:214653 28/67 (42%)
dpr10NP_729591.1 Ig 63..143 CDD:299845 47/79 (59%)
IG_like 210..297 CDD:214653 35/86 (41%)
IGc2 217..287 CDD:197706 30/69 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444677
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.