DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and dpr13

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:229 Identity:95/229 - (41%)
Similarity:140/229 - (61%) Gaps:7/229 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GMVGGEVPPHYWETPYSQP-YFDNSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTV 90
            |:.||      .|:.:..| ||...:...||..:|..|.:.|.|.::|:..||||||:|.|:|||
  Fly   162 GIEGG------MESLFGTPMYFGTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTV 220

  Fly    91 GILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVVSRAKILGN 155
            |:.||::|:||.:.|.:.|::|||:|...|.||:|.|||||||.|..|....|:||.:||:|.|.
  Fly   221 GLTTYSSDERFSATHLKHSEDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSVVEARAEITGP 285

  Fly   156 AELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGGINVITERSTRTSKLLIAKATPA 220
            ...::..||.:.|.|..:|:.....:|:||...|::||....||||.||...::|:|.|.:....
  Fly   286 PIRYLTPGSTLRLQCRVVQNTEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTIQRTRRE 350

  Fly   221 DSGNYTCSPSSSDSASVVVHVINGEHPAAMQHGN 254
            .|||:||..|::..|||:||:..|::||||.||:
  Fly   351 HSGNFTCVASNTQPASVLVHIFKGDNPAAMYHGH 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 44/92 (48%)
IG_like 53..145 CDD:214653 44/91 (48%)
ig 153..227 CDD:278476 24/73 (33%)
IG_like 161..>227 CDD:214653 23/65 (35%)
dpr13NP_001033956.2 V-set 180..276 CDD:284989 44/95 (46%)
IG_like 182..262 CDD:214653 38/79 (48%)
IG_like 285..362 CDD:214653 26/76 (34%)
IGc2 292..361 CDD:197706 25/68 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.