DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and Gm1123

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001074245.1 Gene:Gm1123 / 382097 MGIID:2685969 Length:390 Species:Mus musculus


Alignment Length:221 Identity:46/221 - (20%)
Similarity:84/221 - (38%) Gaps:55/221 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GQAALLHCRV----RNLGDRAVSWIR-------KRDLHILTVGILTYTNDQRFQSLHSE------ 107
            |:...|.|..    ::.|...:.|:|       ..| |:    ::.|:.|:....::.:      
Mouse   159 GETVHLPCMFTFISKDQGPLNIEWLRLSGPNNEAMD-HV----VILYSADKIHDDVYPDLKGRVY 218

  Fly   108 ------GSDEWTLRISSPQPRDSGTYECQVSTEP-KISQGFRLNVV--VSRAKILGNAELFIKS- 162
                  .|.:.::.|::.|..|:|||:|:|.|.| .:::..:|.|.  :....|....:...|: 
Mouse   219 FTSNDIKSGDASINITNVQLSDAGTYQCKVKTYPGTVNRNLQLAVT
DHIGSVSITTPEQTIQKAR 283

  Fly   163 GSDINLTCLAMQSPVP--PSFIYW-----------------YKGKRVMN--YSQRGGINVITERS 206
            |..::|.|....||..  |.||.|                 |...::.:  |....|....|...
Mouse   284 GETVHLPCTFTLSPEDHGPLFIDWMQLTGPQNEVVNRMFIVYLADKIYDNFYQDMKGRVQFTSND 348

  Fly   207 TRT--SKLLIAKATPADSGNYTCSPS 230
            .|:  :.:.|..|..:|:|.|.|..|
Mouse   349 IRSGEASINITDARLSDAGTYQCGVS 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 22/109 (20%)
IG_like 53..145 CDD:214653 22/108 (20%)
ig 153..227 CDD:278476 20/97 (21%)
IG_like 161..>227 CDD:214653 20/89 (22%)
Gm1123NP_001074245.1 V-set 24..139 CDD:284989
IG_like 25..138 CDD:214653
V-set 149..264 CDD:284989 22/109 (20%)
IG_like 152..263 CDD:214653 22/108 (20%)
V-set 274..389 CDD:284989 22/101 (22%)
IG_like 277..388 CDD:214653 22/98 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105520
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.