DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and dpr20

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:283 Identity:83/283 - (29%)
Similarity:136/283 - (48%) Gaps:58/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 HYWETPYSQPYFDNSSR----REVTATVGQAALLHCRVRNLGDRAVSWIRKRD----------LH 86
            |:.:..|. |:|::..|    ..:|...|.:..|:||:..|.|:.|||:|...          |.
  Fly   257 HHHDQRYG-PHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALD 320

  Fly    87 ILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVVSRAK 151
            :||||:.|||.|:|:: :..:..:.|.|:|::.:..|...||||:||.|  .:..::|:.|:..|
  Fly   321 LLTVGMHTYTGDKRYK-MEFQYPNNWRLKITNVKKDDEAIYECQISTHP--PRVIQINLHVNAPK 382

  Fly   152 IL-----GN--AELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYS-QRGGINVITE--RS 206
            ::     |:  .|.:.:..|.:.|:|:.....:..|.::|.....::||. .|||::|.||  ..
  Fly   383 VMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMED 447

  Fly   207 TRTSKLLIAKATPADSGNYTCSPSSSDSASVVVHVINGEHPAAMQHGNSSATCLRPLSSTSVPFV 271
            ...|.|.|||.:..||||||||.|...:.::|||::|||..|.:.||                  
  Fly   448 GANSTLSIAKISKTDSGNYTCSISEFQNFTIVVHILNGESFAELHHG------------------ 494

  Fly   272 LATWMSMTVASVAWNSNLNINWN 294
                     .:|.|:|..   ||
  Fly   495 ---------GAVGWHSTW---WN 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 33/102 (32%)
IG_like 53..145 CDD:214653 32/101 (32%)
ig 153..227 CDD:278476 25/83 (30%)
IG_like 161..>227 CDD:214653 23/68 (34%)
dpr20NP_612066.1 IG_like 278..365 CDD:214653 29/87 (33%)
Ig 279..378 CDD:299845 33/101 (33%)
Ig 400..471 CDD:299845 26/70 (37%)
IG_like 402..480 CDD:214653 27/77 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444725
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.