DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and babos

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster


Alignment Length:210 Identity:52/210 - (24%)
Similarity:86/210 - (40%) Gaps:56/210 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 ILTVG---ILTY----TNDQRFQS---LHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGF 141
            :|.||   :::|    .:|.:.|:   ....|.|:     |:|.|:..       |..|..|:  
  Fly    13 LLIVGSAAVISYPQSSMDDDQMQADDDFDYGGEDQ-----SAPSPQTK-------SPNPVASE-- 63

  Fly   142 RLNVVVSRAKILGNAELFIKSGSDINLTCLAMQSPVPPS--FIYWYKGKRVMNYSQRGGINVITE 204
            ::|..:|...|         .|.|:.|.| .:.|.:..|  .:.||.|..|::    .|.|::..
  Fly    64 KINKTLSVTGI---------RGEDVVLKC-DVGSNLHSSDVVVLWYFGDNVIS----NGKNLVQP 114

  Fly   205 --RSTRTSKLLIAKATPADSGNYTCS--PSSSDSASVVVHVINGEHPAAMQHGNSSATCLRPLSS 265
              :......|.|.||:|..:|:|.|.  ||.|        |:|.:...| :|   |...:.|.||
  Fly   115 NFKLDANYDLTILKASPQVAGSYLCKVLPSGS--------VVNTKVTIA-EH---SLDAIAPESS 167

  Fly   266 TSVPFVLATWMSMTV 280
            ||.....::::..||
  Fly   168 TSAAGSASSFLGCTV 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 15/68 (22%)
IG_like 53..145 CDD:214653 14/67 (21%)
ig 153..227 CDD:278476 19/77 (25%)
IG_like 161..>227 CDD:214653 19/69 (28%)
babosNP_001286719.1 ig 70..154 CDD:278476 27/105 (26%)
IG_like 70..154 CDD:214653 27/105 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.