DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and CG13506

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:392 Identity:78/392 - (19%)
Similarity:125/392 - (31%) Gaps:133/392 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLG-DRAVSWIRKRDLHILTVGILTYTN--DQR 100
            |.|   ||||.:..| |.|..|...:|:|..||.. ..||.|.:.|      :.|....|  .||
  Fly    67 EAP---PYFDVTDLR-VEAKPGDDVILNCDARNFQLSNAVVWYKNR------IIIANGQNPISQR 121

  Fly   101 FQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQ------GFRLNVVVSRAKILGNAELF 159
            .|.:.:.     ::.:.:..|.||..|.|::..: ::.|      |.||:::.....|...::.|
  Fly   122 VQCMLNN-----SILLRNVSPEDSDDYYCEILPQ-RVRQHTALRVGARLSILCDDRDITDRSQTF 180

  Fly   160 -------------------IK-SGSDIN-------------------------LTCLA------- 172
                               || |.:|:|                         ..|||       
  Fly   181 RQGDHHKLECRTYLPDNATIKWSFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQCLADDGSRHP 245

  Fly   173 ---------MQSPV-------------------------PPSFIYWYKGKRVMNYSQRGGINVIT 203
                     ..||:                         |....|:.|..:.:..|.:..:....
  Fly   246 PHGTVHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLKDSV 310

  Fly   204 ERSTRTSKLLIAKATPADSGNYTCSPSSS-DSASVVVHV-INGEHPA---AMQHGNSSAT--CLR 261
            ......:.|::.:.|.:|.|.|.|...:: .|..|.||| .|.|.|.   ....||....  .:|
  Fly   311 HNDHNRTTLIVREVTDSDLGEYLCQVENAIGSNEVKVHVSYNPETPQFEDMTVEGNKVTLHWLVR 375

  Fly   262 P---LSSTSVPFVLA---TWMSMTVASVAWNSNLNINWNWSPDWR-----WHWNPKW----NWSN 311
            .   ||...:.:.|.   ||.::.|.....::|.:..|..:....     ||...|.    .||:
  Fly   376 SHQLLSEAMLDYQLTGSYTWSTVQVLETHRHNNTDNIWKITHQLELSRGVWHARVKTKNTKGWSH 440

  Fly   312 LA 313
            .:
  Fly   441 FS 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 26/101 (26%)
IG_like 53..145 CDD:214653 26/100 (26%)
ig 153..227 CDD:278476 20/159 (13%)
IG_like 161..>227 CDD:214653 18/132 (14%)
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 20/77 (26%)
IGc2 83..146 CDD:197706 18/73 (25%)
IG_like 176..254 CDD:214653 9/77 (12%)
Ig 176..239 CDD:299845 8/62 (13%)
I-set 258..349 CDD:254352 14/90 (16%)
Ig 275..348 CDD:143165 12/72 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.