DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and dpr19

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:309 Identity:93/309 - (30%)
Similarity:137/309 - (44%) Gaps:70/309 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CLVPLWLLLFLDCGMVGGEVPPHYWETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVS 78
            |.:.|....|.|.|.:... ..|:..|..||  |:..:...|.|..|..|:|.|.|:......||
  Fly    12 CFLLLLSSTFSDVGKITSS-QNHFGNTLQSQ--FNTKNNTRVIAQKGGLAILPCVVKVNSPATVS 73

  Fly    79 WIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRL 143
            |||::|..:||||:.|:::|:||...|:.....|:|||.:.:..|.|.||||:|..|..|....|
  Fly    74 WIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQSIVIEL 138

  Fly   144 NVVVSRAKILGNAELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGGINVITE---- 204
            .:|.:.|:|....||.|...|.:.|.|...::...|:|::||...:::||..:||. |:|.    
  Fly   139 KIVEAVAEISSAPELHIDETSTLRLECKLKRATENPAFVFWYHDSKMINYDSQGGF-VVTSIGQS 202

  Fly   205 --------RSTRTSK----------------LL------------IAKATP-------------- 219
                    ||:..:|                ||            :..:||              
  Fly   203 NPQSGQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPAANVPSSTPYMTQQHQSAYLLNP 267

  Fly   220 ------------ADSGNYTCSPSSSDSASVVVHVINGEHPAAMQHGNSS 256
                        ..:|||||:||::..||:.|||:.||..|||||.|.|
  Fly   268 SVSVLTVKQVNFRHAGNYTCAPSNARPASITVHVLRGEKTAAMQHANRS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 36/92 (39%)
IG_like 53..145 CDD:214653 36/91 (40%)
ig 153..227 CDD:278476 26/139 (19%)
IG_like 161..>227 CDD:214653 23/131 (18%)
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 32/76 (42%)
IGc2 55..125 CDD:197706 28/69 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.