DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and DIP-eta

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:329 Identity:86/329 - (26%)
Similarity:135/329 - (41%) Gaps:57/329 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CPRALKAICLVPLWLLLFLDCGMVGGEVPPHYWETP-YSQPYFDNSSRREVTATVGQAALLHCRV 69
            |.:...|:.::.|.:|:...|.....|||......| :|.|..:      :||.||:.|.|.|.|
  Fly     8 CRKQTCALSVILLLILMSQQCYPQRVEVPAEVIVDPKFSSPIVN------MTAPVGRDAFLTCVV 66

  Fly    70 RNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTE 134
            ::||...|:|:|.....|||:.....|.:||....:|| ...||:||...:..|.|.|.||::|:
  Fly    67 QDLGPYKVAWLRVDTQTILTIQNHVITKNQRIGIANSE-HKTWTMRIKDIKESDKGWYMCQINTD 130

  Fly   135 PKISQGFRLNVVVSRAKILG---NAELFIKSGSDINLTCLAMQSPVPPSFIYWYK---------- 186
            |..||...|:|||. ..||.   :.::.::.||::.|.|.|..||.|.  |.|.:          
  Fly   131 PMKSQMGYLDVVVP-PDILDYPTSTDMVVREGSNVTLKCAATGSPEPT--ITWRRESGVPIELAT 192

  Fly   187 GKRVMNYSQRGGINVITERSTRTSKLLIAKATPADSGNYTC------SPSSSDSASVVVH----- 240
            |:.||              |...:.|:|........|.|.|      .||.|...::|||     
  Fly   193 GEEVM--------------SIEGTDLVIPNVRRHHMGAYLCIASNGVPPSVSKRITLVVHFPPMI 243

  Fly   241 VINGEHPAAMQHGNSSATCLRPLSSTSVPFVLATWM----SMTVASVAWNSNLNINWNWSPDWRW 301
            .:..:...|::....:..|    .|.:.|..:..|.    .:......:::|:.....:....|.
  Fly   244 TVQNQLIGAVEGKGVTLDC----ESEAYPKSINYWTRERGEIVPPGGKYSANVTEIGGYRNSMRL 304

  Fly   302 HWNP 305
            |.||
  Fly   305 HINP 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 35/92 (38%)
IG_like 53..145 CDD:214653 35/91 (38%)
ig 153..227 CDD:278476 19/86 (22%)
IG_like 161..>227 CDD:214653 18/75 (24%)
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 35/96 (36%)
IG_like 51..137 CDD:214653 34/92 (37%)
IG_like 153..237 CDD:214653 22/99 (22%)
Ig 161..224 CDD:299845 19/78 (24%)
IG_like 252..335 CDD:214653 10/61 (16%)
Ig 258..333 CDD:143165 9/55 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.