DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and DIP-eta

DIOPT Version :10

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_608946.3 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:329 Identity:86/329 - (26%)
Similarity:135/329 - (41%) Gaps:57/329 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CPRALKAICLVPLWLLLFLDCGMVGGEVPPHYWETP-YSQPYFDNSSRREVTATVGQAALLHCRV 69
            |.:...|:.::.|.:|:...|.....|||......| :|.|..:      :||.||:.|.|.|.|
  Fly     8 CRKQTCALSVILLLILMSQQCYPQRVEVPAEVIVDPKFSSPIVN------MTAPVGRDAFLTCVV 66

  Fly    70 RNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTE 134
            ::||...|:|:|.....|||:.....|.:||....:|| ...||:||...:..|.|.|.||::|:
  Fly    67 QDLGPYKVAWLRVDTQTILTIQNHVITKNQRIGIANSE-HKTWTMRIKDIKESDKGWYMCQINTD 130

  Fly   135 PKISQGFRLNVVVSRAKILG---NAELFIKSGSDINLTCLAMQSPVPPSFIYWYK---------- 186
            |..||...|:|||. ..||.   :.::.::.||::.|.|.|..||.|.  |.|.:          
  Fly   131 PMKSQMGYLDVVVP-PDILDYPTSTDMVVREGSNVTLKCAATGSPEPT--ITWRRESGVPIELAT 192

  Fly   187 GKRVMNYSQRGGINVITERSTRTSKLLIAKATPADSGNYTC------SPSSSDSASVVVH----- 240
            |:.||              |...:.|:|........|.|.|      .||.|...::|||     
  Fly   193 GEEVM--------------SIEGTDLVIPNVRRHHMGAYLCIASNGVPPSVSKRITLVVHFPPMI 243

  Fly   241 VINGEHPAAMQHGNSSATCLRPLSSTSVPFVLATWM----SMTVASVAWNSNLNINWNWSPDWRW 301
            .:..:...|::....:..|    .|.:.|..:..|.    .:......:::|:.....:....|.
  Fly   244 TVQNQLIGAVEGKGVTLDC----ESEAYPKSINYWTRERGEIVPPGGKYSANVTEIGGYRNSMRL 304

  Fly   302 HWNP 305
            |.||
  Fly   305 HINP 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 IG_like 53..145 CDD:214653 35/91 (38%)
Ig strand A' 55..57 CDD:409355 0/1 (0%)
Ig strand B 61..69 CDD:409355 3/7 (43%)
CDR1 69..75 CDD:409355 3/5 (60%)
Ig strand C 76..82 CDD:409355 2/5 (40%)
CDR2 85..101 CDD:409355 5/15 (33%)
Ig strand D 101..106 CDD:409355 0/4 (0%)
FR3 102..131 CDD:409355 10/28 (36%)
Ig strand E 110..117 CDD:409355 3/6 (50%)
Ig strand F 125..132 CDD:409355 4/6 (67%)
IG_like 161..>227 CDD:214653 18/75 (24%)
Ig strand B 166..170 CDD:409353 1/3 (33%)
Ig strand C 181..185 CDD:409353 1/3 (33%)
Ig strand E 206..214 CDD:409353 2/7 (29%)
DIP-etaNP_608946.3 IG_like 51..137 CDD:214653 34/92 (37%)
Ig strand B 60..64 CDD:409353 2/3 (67%)
Ig strand C 73..77 CDD:409353 1/3 (33%)
Ig strand E 108..112 CDD:409353 2/3 (67%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 2/2 (100%)
IgI_1_MuSK 145..237 CDD:409562 24/107 (22%)
Ig strand A 145..148 CDD:409562 0/2 (0%)
Ig strand A' 153..158 CDD:409562 0/4 (0%)
Ig strand B 164..171 CDD:409562 2/6 (33%)
Ig strand C 177..182 CDD:409562 2/6 (33%)
Ig strand C' 184..186 CDD:409562 0/1 (0%)
Ig strand D 194..197 CDD:409562 0/2 (0%)
Ig strand E 202..208 CDD:409562 2/5 (40%)
Ig strand F 215..222 CDD:409562 3/6 (50%)
Ig strand G 229..237 CDD:409562 1/7 (14%)
IG_like 252..335 CDD:214653 10/61 (16%)
Ig strand B 258..262 CDD:409353 0/3 (0%)
Ig strand C 271..282 CDD:409353 1/10 (10%)
Ig strand E 301..306 CDD:409353 1/4 (25%)
Ig strand F 316..321 CDD:409353
Ig strand G 329..332 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.