DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and fipi

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster


Alignment Length:311 Identity:56/311 - (18%)
Similarity:92/311 - (29%) Gaps:123/311 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 AVSWIRKRDLHILTV---GILTYTNDQRFQSLHSEGSDEWTLRISSPQPR--------------- 122
            ||:|....:...|:.   .::.|||:...            ::..||.|:               
  Fly    15 AVAWANHHESLSLSPAEHSVVRYTNESLI------------VQCRSPDPKVELHWKSPKGEIIRE 67

  Fly   123 -------------------------DSGTYECQVSTEPKISQGFRLNVVVSRAKILGNAELF-IK 161
                                     |.|.:.|:.:.....|:.|.| :|..:.....||.:. :|
  Fly    68 HKGRIHIEQTSTEQLKIVFAHIALADKGNWSCEAADGSLHSKSFDL-IVYQKITFTENATVMTVK 131

  Fly   162 SGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGGINVITERSTRTSK-------LLIAKATP 219
            .|....:.|.....| .|:..:.:.|:            .|:..:...||       |||.|.|.
  Fly   132 EGEKATILCEVKGEP-QPNVTWHFNGQ------------PISAGAADDSKFRILADGLLINKVTQ 183

  Fly   220 ADSGNYTCS-------PSSSDSASVVVHVINGEHPAAMQHGNSSATCLRPLSSTSVPFVLATWMS 277
            .|:|.|.|.       .|.....:|::.:   ||              :|:.| ..|||     |
  Fly   184 NDTGEYACRAYQVNSIASDMQERTVLMKI---EH--------------KPIWS-KTPFV-----S 225

  Fly   278 MTVASVAWNSNLNINWNWSPDWRWHWNPKWN----------------WSNL 312
            :..|.:...:.|.......|...:.|..|.|                ||:|
  Fly   226 LKYAYINGTATLMCEALAEPPANFTWYRKHNKLHSNNRLYTIQSDSYWSSL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 16/112 (14%)
IG_like 53..145 CDD:214653 16/111 (14%)
ig 153..227 CDD:278476 19/81 (23%)
IG_like 161..>227 CDD:214653 17/72 (24%)
fipiNP_787975.1 IG_like 33..115 CDD:214653 12/94 (13%)
I-set 128..202 CDD:254352 18/86 (21%)
Ig 133..>193 CDD:299845 17/72 (24%)
IG_like 228..307 CDD:214653 9/49 (18%)
Ig 235..305 CDD:143165 8/42 (19%)
FN3 312..415 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.