Sequence 1: | NP_001014616.2 | Gene: | dpr4 / 3346160 | FlyBaseID: | FBgn0053512 | Length: | 323 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_608822.1 | Gene: | bdl / 33635 | FlyBaseID: | FBgn0028482 | Length: | 719 | Species: | Drosophila melanogaster |
Alignment Length: | 204 | Identity: | 55/204 - (26%) |
---|---|---|---|
Similarity: | 81/204 - (39%) | Gaps: | 36/204 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 NSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSE---GSD 110
Fly 111 EWTLRISSPQPRDSGTYECQVST---EPKISQGFRLNVVVSRAKILGNAELFIKSGSDINLTCLA 172
Fly 173 MQSPVPPSFIYWYK-GKRVMNYSQRGGINVITERSTRTSKLLIAKATPADSGNYTCSPSS---SD 233
Fly 234 SASVVVHVI 242 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr4 | NP_001014616.2 | V-set | 53..146 | CDD:284989 | 28/98 (29%) |
IG_like | 53..145 | CDD:214653 | 27/97 (28%) | ||
ig | 153..227 | CDD:278476 | 17/74 (23%) | ||
IG_like | 161..>227 | CDD:214653 | 15/66 (23%) | ||
bdl | NP_608822.1 | IG_like | 42..128 | CDD:214653 | |
Ig | 43..131 | CDD:299845 | |||
I-set | 153..242 | CDD:254352 | 28/101 (28%) | ||
Ig | 157..242 | CDD:299845 | 28/101 (28%) | ||
Ig_2 | 252..337 | CDD:290606 | 25/92 (27%) | ||
IG_like | 260..327 | CDD:214653 | 18/73 (25%) | ||
I-set | 341..428 | CDD:254352 | |||
IGc2 | 356..419 | CDD:197706 | |||
FN3 | 435..524 | CDD:238020 | |||
FN3 | 554..636 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |