DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and bdl

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:204 Identity:55/204 - (26%)
Similarity:81/204 - (39%) Gaps:36/204 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 NSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSE---GSD 110
            |.:.||     ||.|..||.:::..:...||.:.        |:|.    |..|.|...   |.|
  Fly   159 NQTIRE-----GQTAFFHCVMKHPENSQASWYKD--------GVLL----QEVQDLVRRFYMGPD 206

  Fly   111 EWTLRISSPQPRDSGTYECQVST---EPKISQGFRLNVVVSRAKILGNAELFIKSGSDINLTCLA 172
             .:|.|......|.|.|||:|..   |.:.::.| ||:......|....|:|:..|....|.|..
  Fly   207 -GSLSIDPTMMSDLGEYECKVRNSDGELQTAKAF-LNIQYKAKVIYAPPEVFLPYGQPAVLDCHF 269

  Fly   173 MQSPVPPSFIYWYK-GKRVMNYSQRGGINVITERSTRTSKLLIAKATPADSGNYTCSPSS---SD 233
            ..:| |...:.|.| |....:|:..|....:      ...|..||.....:|:|||:|.:   :|
  Fly   270 RANP-PLKNLRWEKDGLLFDSYNVPGVFYKM------NGSLFFAKVDENHAGSYTCTPYNDLGTD 327

  Fly   234 SASVVVHVI 242
            ..|.|:.||
  Fly   328 GPSPVISVI 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 28/98 (29%)
IG_like 53..145 CDD:214653 27/97 (28%)
ig 153..227 CDD:278476 17/74 (23%)
IG_like 161..>227 CDD:214653 15/66 (23%)
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 28/101 (28%)
Ig 157..242 CDD:299845 28/101 (28%)
Ig_2 252..337 CDD:290606 25/92 (27%)
IG_like 260..327 CDD:214653 18/73 (25%)
I-set 341..428 CDD:254352
IGc2 356..419 CDD:197706
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.