DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and CG33543

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:352 Identity:74/352 - (21%)
Similarity:125/352 - (35%) Gaps:107/352 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LKAICLVPLWLLLFLDCGMVG------------GEVPPHYWETPYSQPYFDNSSRREVTATVGQA 62
            |.|:|.: |.|||..:..::|            |..||   :.|.:.|.....|...:|..|.::
  Fly     4 LIALCSL-LLLLLSQNAAILGQLDSTSSGGSGTGGAPP---DRPPTPPLSLQPSTPSITHFVNES 64

  Fly    63 ALLHCRVRNLGDRAVSWIRKRD------------LHI--LTVGILTYTNDQRFQSLHSEGSDEWT 113
            .::.|:... .|....|   ||            :||  .|.|:|...    |:.:..|....||
  Fly    65 FIIFCQTVQ-KDIDTKW---RDPRGQTRENTKGRVHIEKKTTGLLALV----FEHIALEDRGNWT 121

  Fly   114 LRISSPQPRDSGTYECQVSTEPKISQGFRLNVVVSRAKILGNAELF--IKSGSDINLTCLAMQSP 176
            ..::..:..:.     .|:.|.:....|.|  :|::....|..|..  ::.|.|..:.|.....|
  Fly   122 CEVNGNRNGNR-----NVNVEREFLASFEL--LVNQKISFGKTEQVQSVREGRDAMVNCFVEGMP 179

  Fly   177 VPPSFIYW-YKGKRVMNYSQRGGINVI--TERSTRTSKLLIAKATPADSGNYTC-----SPSSSD 233
            .|.  :.| |.|:.         ||.:  |:.:..::.|.|...:.||:|.|||     :|:.||
  Fly   180 APE--VSWLYNGEY---------INTVNSTKHNRLSNGLYIRNVSQADAGEYTCRAMRITPTFSD 233

  Fly   234 SASVVVHVINGEHPAAMQHGNSSATCLRPLSSTSVPFVLATWMSMTVASVAWNSNLNINW----- 293
            |..:.:.:       .:||        :|           .|.        :|..|.:.:     
  Fly   234 SDQITILL-------RIQH--------KP-----------HWF--------FNETLPVQYAYVGG 264

  Fly   294 --NWSPDWRWHWNPKWNWSNLAAGLVG 318
              |.|.|......|.:.|.:...|:||
  Fly   265 AVNLSCDAMGEPPPSFTWLHNNKGIVG 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 20/106 (19%)
IG_like 53..145 CDD:214653 20/105 (19%)
ig 153..227 CDD:278476 19/78 (24%)
IG_like 161..>227 CDD:214653 17/68 (25%)
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 19/69 (28%)
IG_like 256..336 CDD:214653 8/36 (22%)
IGc2 263..327 CDD:197706 8/29 (28%)
FN3 341..445 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.