DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and DIP-beta

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:215 Identity:59/215 - (27%)
Similarity:89/215 - (41%) Gaps:32/215 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VTATVGQAALLHCRVRNLGDRAVS-----------WIRKRDLHILTVGILTYTNDQRFQSLHSEG 108
            ||...|:.|...|.|.|||...||           ||:.....||.:.....||:.|....|:: 
  Fly   107 VTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHND- 170

  Fly   109 SDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVVSRAKILG---NAELFIKSGSDINLTC 170
            .:.|||.|...:..|:|.|.|||:|:|...|...|.||:. ..|:.   :.::.:..|....|.|
  Fly   171 YNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVI
P-PDIINEETSGDMMVPEGGSAKLVC 234

  Fly   171 LAMQSPVPPSFIYWYK--GKRVMNYSQRGGINVITERSTRTSKLLIAKATPADSGNYTC------ 227
            .|...|.|.  |.|.:  |:.::  ::.|.......:|.....|.::|.|.::.|.|.|      
  Fly   235 RARGHPKPK--ITWRREDGREII--ARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGV 295

  Fly   228 SPSSSDSASVVVHVINGEHP 247
            .|:.|....:.||.    ||
  Fly   296 PPTVSKRMKLQVHF----HP 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 33/101 (33%)
IG_like 53..145 CDD:214653 33/100 (33%)
ig 153..227 CDD:278476 16/78 (21%)
IG_like 161..>227 CDD:214653 16/67 (24%)
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 34/102 (33%)
ig 102..195 CDD:278476 29/88 (33%)
IG_like 219..307 CDD:214653 19/91 (21%)
Ig 221..307 CDD:299845 19/89 (21%)
Ig 311..404 CDD:299845 1/1 (100%)
IG_like 327..405 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.