Sequence 1: | NP_001014616.2 | Gene: | dpr4 / 3346160 | FlyBaseID: | FBgn0053512 | Length: | 323 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_723828.1 | Gene: | DIP-kappa / 318958 | FlyBaseID: | FBgn0051814 | Length: | 672 | Species: | Drosophila melanogaster |
Alignment Length: | 206 | Identity: | 62/206 - (30%) |
---|---|---|---|
Similarity: | 93/206 - (45%) | Gaps: | 42/206 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 VTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVG----------ILTYTNDQRFQSLHSEGS 109
Fly 110 DEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVVSRAKILG--NAELFIKSGSDINLTCLA 172
Fly 173 MQSPVPPSFIYWYK--GKRVMNYSQRGG--INVITERSTRTSKLL-IAKATPADSGNYTCSPSSS 232
Fly 233 --DSASVVVHV 241 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr4 | NP_001014616.2 | V-set | 53..146 | CDD:284989 | 34/100 (34%) |
IG_like | 53..145 | CDD:214653 | 34/99 (34%) | ||
ig | 153..227 | CDD:278476 | 19/80 (24%) | ||
IG_like | 161..>227 | CDD:214653 | 18/70 (26%) | ||
DIP-kappa | NP_723828.1 | Ig | 80..172 | CDD:299845 | 34/99 (34%) |
IG_like | 82..174 | CDD:214653 | 35/101 (35%) | ||
IG_like | 184..267 | CDD:214653 | 24/94 (26%) | ||
IGc2 | 191..255 | CDD:197706 | 20/75 (27%) | ||
IG_like | 282..368 | CDD:214653 | |||
Ig | 288..367 | CDD:143165 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |