| Sequence 1: | NP_001014616.2 | Gene: | dpr4 / 3346160 | FlyBaseID: | FBgn0053512 | Length: | 323 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_572419.1 | Gene: | dpr14 / 31702 | FlyBaseID: | FBgn0029974 | Length: | 340 | Species: | Drosophila melanogaster |
| Alignment Length: | 43 | Identity: | 13/43 - (30%) |
|---|---|---|---|
| Similarity: | 21/43 - (48%) | Gaps: | 10/43 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1025 ALIKCSFCEYHTHVASEMGLHMQNNHRKE-TGAKEVISDLYMG 1066 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr4 | NP_001014616.2 | IG_like | 53..145 | CDD:214653 | |
| Ig strand A' | 55..57 | CDD:409355 | |||
| Ig strand B | 61..69 | CDD:409355 | |||
| CDR1 | 69..75 | CDD:409355 | |||
| Ig strand C | 76..82 | CDD:409355 | |||
| CDR2 | 85..101 | CDD:409355 | |||
| Ig strand D | 101..106 | CDD:409355 | |||
| FR3 | 102..131 | CDD:409355 | |||
| Ig strand E | 110..117 | CDD:409355 | |||
| Ig strand F | 125..132 | CDD:409355 | |||
| IG_like | 161..>227 | CDD:214653 | |||
| Ig strand B | 166..170 | CDD:409353 | |||
| Ig strand C | 181..185 | CDD:409353 | |||
| Ig strand E | 206..214 | CDD:409353 | |||
| dpr14 | NP_572419.1 | Ig | 81..175 | CDD:472250 | 13/43 (30%) |
| Ig strand B | 92..96 | CDD:409353 | |||
| Ig strand C | 105..109 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 142..146 | CDD:409353 | |||
| Ig strand F | 156..161 | CDD:409353 | |||
| Ig strand G | 168..171 | CDD:409353 | |||
| IG_like | 191..279 | CDD:214653 | |||
| Ig strand B | 201..205 | CDD:409473 | |||
| Ig strand C | 214..220 | CDD:409473 | |||
| Ig strand E | 248..252 | CDD:409473 | |||
| Ig strand F | 262..267 | CDD:409473 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||