DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and Fas2

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:252 Identity:64/252 - (25%)
Similarity:94/252 - (37%) Gaps:38/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ATVGQAALLHCRVRNLGDRAVSWIR-KRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQ 120
            |..|:....:|..|......:|||| ...|::.|.        .|||.....|    .:.|||..
  Fly   241 AVEGKPFAANCTARGKPVPEISWIRDATQLNVATA--------DRFQVNPQTG----LVTISSVS 293

  Fly   121 PRDSGTYECQVSTEP-KISQGFRLNVVVSRAKILGNAELFIKSGS---DINLTCLAMQSPVPP-S 180
            ..|.|||.|...... .:.|..:|||:| |.:|.   ||:..:|:   :|.:||.|...|.|. :
  Fly   294 QDDYGTYTCLAKNRAGVVDQKTKLNV
LV-RPQIY---ELYNVTGARTKEIAITCRAKGRPAPAIT 354

  Fly   181 FIYWYKGKRVMNYSQRGGINVI------TERSTRTSKLLIAKATPADSGNYTCSPSSSDSASVVV 239
            |..|...:...|..|.....:|      .||...|..|.|:.|..:|.|.|.|...:..:.:...
  Fly   355 FRRWGTQEEYTNGQQDDDPRIILEPNFDEERGESTGTLRISNAERSDDGLYQCIARNKGADAYKT 419

  Fly   240 HVINGEHPAAMQHGNSSATCLRPLSSTSVPFVLATWMSMTVASVAWNSNLNINWNWS 296
            ..|..|......|...    |.|:.|........:.::|.:      .|..|.|:|:
  Fly   420 GHITVEFAPDFSHMKE----LPPVFSWEQRKANLSCLAMGI------PNATIEWHWN 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 25/90 (28%)
IG_like 53..145 CDD:214653 24/89 (27%)
ig 153..227 CDD:278476 23/83 (28%)
IG_like 161..>227 CDD:214653 21/75 (28%)
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653
IGc2 152..209 CDD:197706
I-set 230..319 CDD:254352 24/89 (27%)
IGc2 243..309 CDD:197706 21/77 (27%)
IG_like 330..424 CDD:214653 23/93 (25%)
IGc2 339..412 CDD:197706 21/72 (29%)
Ig 447..518 CDD:143165 5/26 (19%)
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.