DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and kirre

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster


Alignment Length:247 Identity:65/247 - (26%)
Similarity:93/247 - (37%) Gaps:58/247 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GGEVPPHYWETPYSQPYFDNSSRREVTATVGQAALLHCRV-RNLGDRAVSWIRKRDLHILTVGIL 93
            ||:   |:...|..|           ||.||....|.||| ..:|  |:.| .|.|.     |:.
  Fly    80 GGQ---HFAMEPQDQ-----------TAVVGSRVTLPCRVMEKVG--ALQW-TKDDF-----GLG 122

  Fly    94 TYTNDQRFQSLHSEGSDE---WTLRISSPQPRDSGTYECQVSTEPKISQGFR-----LNVVV--S 148
            .:.|...|:.....||||   ::|.|......|...|:|||...|:..||.|     |.|:|  .
  Fly   123 QHRNLSGFERYSMVGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPE 187

  Fly   149 RAKILGNAELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGGINVITE------RST 207
            ..||.....|......:|.|.|:: |...|.:.|.|..|   :......||..:.|      |.|
  Fly   188 APKITQGDYLVTTEDREIELECVS-QGGKPAAEITWIDG---LGNVLTKGIEYVKEPLADSRRIT 248

  Fly   208 RTSKLLIAKATPADSGNYTC-SPSSSD--------------SASVVVHVING 244
            ..|.|.:|......:..:|| :.:::|              :..|:|.|:.|
  Fly   249 ARSILKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEVKYAPKVIVSVVGG 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 32/101 (32%)
IG_like 53..145 CDD:214653 32/100 (32%)
ig 153..227 CDD:278476 17/79 (22%)
IG_like 161..>227 CDD:214653 16/71 (23%)
kirreNP_001245505.1 Ig 87..183 CDD:299845 34/114 (30%)
IG_like 88..182 CDD:214653 34/112 (30%)
C2-set_2 189..279 CDD:285423 22/93 (24%)
Ig_2 307..379 CDD:290606
I-set 382..462 CDD:254352
IGc2 396..446 CDD:197706
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.