DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and Kirrel1

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_006232737.1 Gene:Kirrel1 / 310695 RGDID:727883 Length:805 Species:Rattus norvegicus


Alignment Length:238 Identity:58/238 - (24%)
Similarity:97/238 - (40%) Gaps:64/238 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTND----- 98
            :|.:||...|.      |...|..|:|.|.:.|..                 ||:.:|.|     
  Rat    52 QTRFSQEPADQ------TVVAGHRAVLPCVLLNYS-----------------GIVQWTKDGLALG 93

  Fly    99 --------QRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVV--SRAKIL 153
                    .|::.:.|..:.::.|.|:..:..|..:||||.:.....|:..:|.|::  ...:|.
  Rat    94 MGQGLKAWPRYRVVGSADAGQYNLEITDAELSDDASYECQATEAALRSRRAKLTVLIPPEDTRID 158

  Fly   154 GNAELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGGINVITE------RSTRTSKL 212
            |...:.:::|:..||||.|..:. |.:.|.|::     :.:|:.|....||      |.|..|:|
  Rat   159 GGPVILLQAGTPYNLTCRAFNAK-PAATIIWFR-----DGTQQEGAVTSTELLKDGKRETTISQL 217

  Fly   213 LIAKATPADSGN-YTCS------PSSSD-SASVVVHVINGEHP 247
            || :.|..|.|. :||.      |:..: |..:.||     ||
  Rat   218 LI-QPTDLDIGRVFTCRSMNEAIPNGKETSIELDVH-----HP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 21/105 (20%)
IG_like 53..145 CDD:214653 21/104 (20%)
ig 153..227 CDD:278476 23/80 (29%)
IG_like 161..>227 CDD:214653 22/72 (31%)
Kirrel1XP_006232737.1 I-set 54..148 CDD:254352 24/116 (21%)
Ig 57..148 CDD:299845 23/113 (20%)
Ig2_KIRREL3-like 170..251 CDD:143236 25/87 (29%)
I-set 255..336 CDD:254352 58/238 (24%)
Ig_2 259..337 CDD:290606
Ig_2 340..437 CDD:290606
IG_like 346..437 CDD:214653
Ig5_KIRREL3 439..536 CDD:143306
IG_like 451..536 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.