DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and ncam1a

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_009293555.1 Gene:ncam1a / 30447 ZFINID:ZDB-GENE-990415-31 Length:1010 Species:Danio rerio


Alignment Length:239 Identity:59/239 - (24%)
Similarity:85/239 - (35%) Gaps:64/239 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 TATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQ 120
            ||.:.||..|.|......:..|.|.|         |.....:|::: ||:.:||:   |.|....
Zfish   221 TADINQAVTLACHADGYPEPTVKWAR---------GNTELESDEKY-SLNEDGSE---LTIKDVN 272

  Fly   121 PRDSGTYEC---------------QVSTEPKISQGFRLNVVVSRAKILGNAELFIKSGSDINLTC 170
            ..|.|.|:|               .|..:|||:  |..|...|..:            ..|.|||
Zfish   273 KLDEGDYKCIARNKAGERSEEVTLNVFVQPKIT--FLENQTASELE------------EQITLTC 323

  Fly   171 LAMQSPVPPSFIYWYKGKRVMNYSQRGGI-----------NVITERSTRTSKLLIAKATPADSGN 224
            .|...|.|.  |.|..|:||...:::...           ||:.....|.|.|.:......|:|.
Zfish   324 EATGDPTPN--IIWSFGRRVFTENEQASWTRPEKHKSLDGNVVVRSDARVSSLTLKYVQFTDAGQ 386

  Fly   225 YTCSPSSS---DSASVVVHV-----INGEHPAAMQHGN-SSATC 259
            |.|:..:|   |..|:.:.|     |.|........|| ::.||
Zfish   387 YLCTARNSIGQDIQSMYLEVRYAPKIQGPQAVFTWEGNPANITC 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 27/104 (26%)
IG_like 53..145 CDD:214653 26/103 (25%)
ig 153..227 CDD:278476 20/84 (24%)
IG_like 161..>227 CDD:214653 20/76 (26%)
ncam1aXP_009293555.1 Ig 20..112 CDD:299845
I-set 21..111 CDD:254352
IG_like 121..200 CDD:214653
IGc2 128..189 CDD:197706
Ig 208..301 CDD:299845 22/92 (24%)
IG_like 219..298 CDD:214653 21/89 (24%)
Ig 300..406 CDD:299845 30/121 (25%)
IG_like 308..406 CDD:214653 26/111 (23%)
ig 413..498 CDD:278476 5/18 (28%)
IG_like 415..498 CDD:214653 4/16 (25%)
fn3 505..589 CDD:278470
FN3 624..715 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.