| Sequence 1: | NP_001014616.2 | Gene: | dpr4 / 3346160 | FlyBaseID: | FBgn0053512 | Length: | 323 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038944182.1 | Gene: | Lsamp / 29561 | RGDID: | 71102 | Length: | 378 | Species: | Rattus norvegicus |
| Alignment Length: | 298 | Identity: | 69/298 - (23%) |
|---|---|---|---|
| Similarity: | 123/298 - (41%) | Gaps: | 61/298 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 49 NSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWT 113
Fly 114 LRISSPQPRDSGTYECQVST--EPKISQGFRLNVVVSRAKILGNAELFIKSGSDINLTCLAMQSP 176
Fly 177 VPPSFIYW---------YKGKRVMNYSQRGGINVITERSTRTSKLLIAKATPADSGNYTCSPSSS 232
Fly 233 DSASVVVHV-INGEHPAAMQHGNSS-ATCLRPLS----STSVPFVLATWM----------SMTVA 281
Fly 282 SVAWNSNLNINWNWSPDWRWHWNPKWNWSNLAAGLVGI 319 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr4 | NP_001014616.2 | V-set | 53..146 | CDD:284989 | 28/94 (30%) |
| IG_like | 53..145 | CDD:214653 | 28/93 (30%) | ||
| ig | 153..227 | CDD:278476 | 17/82 (21%) | ||
| IG_like | 161..>227 | CDD:214653 | 17/74 (23%) | ||
| Lsamp | XP_038944182.1 | Ig | 55..145 | CDD:416386 | 28/93 (30%) |
| FR1 | 55..71 | CDD:409353 | 4/15 (27%) | ||
| Ig strand A' | 56..62 | CDD:409353 | 1/5 (20%) | ||
| Ig strand B | 64..72 | CDD:409353 | 3/7 (43%) | ||
| CDR1 | 72..76 | CDD:409353 | 1/3 (33%) | ||
| FR2 | 77..84 | CDD:409353 | 2/7 (29%) | ||
| Ig strand C | 77..83 | CDD:409353 | 2/6 (33%) | ||
| CDR2 | 85..95 | CDD:409353 | 2/11 (18%) | ||
| Ig strand C' | 87..90 | CDD:409353 | 1/2 (50%) | ||
| Ig strand C' | 92..95 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 96..131 | CDD:409353 | 11/35 (31%) | ||
| Ig strand D | 100..107 | CDD:409353 | 2/7 (29%) | ||
| Ig strand E | 110..116 | CDD:409353 | 3/5 (60%) | ||
| Ig strand F | 123..131 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 132..136 | CDD:409353 | 1/3 (33%) | ||
| Ig strand G | 136..145 | CDD:409353 | 4/8 (50%) | ||
| FR4 | 138..145 | CDD:409353 | 2/6 (33%) | ||
| Ig_3 | 148..218 | CDD:404760 | 18/92 (20%) | ||
| Ig strand A' | 155..160 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 166..173 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 179..184 | CDD:409353 | 2/4 (50%) | ||
| Ig strand D | 190..193 | CDD:409353 | 0/2 (0%) | ||
| Ig strand E | 197..203 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 210..217 | CDD:409353 | 3/6 (50%) | ||
| Ig strand G | 224..232 | CDD:409353 | 2/7 (29%) | ||
| Ig_3 | 235..311 | CDD:404760 | 16/82 (20%) | ||
| Ig strand B | 252..256 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 265..269 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 290..294 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 304..309 | CDD:409353 | 1/4 (25%) | ||
| Ig strand G | 318..321 | CDD:409353 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||