DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and dpr7

DIOPT Version :10

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster


Alignment Length:266 Identity:117/266 - (43%)
Similarity:168/266 - (63%) Gaps:30/266 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 TPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSL 104
            |...:|:||:.|.|.|:|.|.:.|:|.|||:|.|:|.|||:|||||||||..|.|||.||||..:
  Fly    46 TNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVI 110

  Fly   105 HSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVV------------------SRAK 151
            |..||::|.|:|...||||||.|||||:|||||:....|.|:.                  :|||
  Fly   111 HPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAK 175

  Fly   152 ILGNAELFIKSGSDINLTC-LAMQSPVPPSFIYWYKGKRVMNY-SQRGGINVITERST--RTSKL 212
            |||:.|:.:|..|.|.|.| :.:.:|    .:.||.|..|::: |.||||::.||::.  .||:|
  Fly   176 ILGSTEIHVKRDSTIALACSVNIHAP----SVIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRL 236

  Fly   213 LIAKATPADSGNYTCSPSSSDSASVVVHVINGEHPAAMQHGNSSATCLRPLSSTSVPFVLATWMS 277
            ::.:|:..|||||||.|:.:..|||.|||:.||.|||||  .|||..:|  :.|::..:::|.:.
  Fly   237 MLTRASLRDSGNYTCVPNGAIPASVRVHVLTGEQPAAMQ--TSSAIRIR--AFTAMITIISTKVL 297

  Fly   278 MTVASV 283
            :.::|:
  Fly   298 LYISSL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 IG_like 53..145 CDD:214653 55/91 (60%)
Ig strand A' 55..57 CDD:409355 1/1 (100%)
Ig strand B 61..69 CDD:409355 3/7 (43%)
CDR1 69..75 CDD:409355 3/5 (60%)
Ig strand C 76..82 CDD:409355 3/5 (60%)
CDR2 85..101 CDD:409355 11/15 (73%)
Ig strand D 101..106 CDD:409355 1/4 (25%)
FR3 102..131 CDD:409355 15/28 (54%)
Ig strand E 110..117 CDD:409355 2/6 (33%)
Ig strand F 125..132 CDD:409355 5/6 (83%)
IG_like 161..>227 CDD:214653 26/69 (38%)
Ig strand B 166..170 CDD:409353 2/3 (67%)
Ig strand C 181..185 CDD:409353 0/3 (0%)
Ig strand E 206..214 CDD:409353 3/9 (33%)
dpr7NP_001096850.2 V-set 56..145 CDD:462230 55/88 (63%)
Ig 184..267 CDD:472250 35/86 (41%)
Ig strand B 190..194 CDD:409353 2/3 (67%)
Ig strand C 202..206 CDD:409353 0/3 (0%)
Ig strand E 234..238 CDD:409353 2/3 (67%)
Ig strand G 261..264 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.