DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and dpr1

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster


Alignment Length:259 Identity:131/259 - (50%)
Similarity:160/259 - (61%) Gaps:25/259 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 WLLLFLDCGMVGG------EVPPHYWETPYSQ----PYFDNSSRREVTATVGQAALLHCRVRNLG 73
            |||| |...::.|      ..||....|..|.    ||||....|.:|.||||...|||||..||
  Fly    18 WLLL-LSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLG 81

  Fly    74 DRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKIS 138
            |:.|||||||||||||.|..|||:|||||.|..:||..|||:|..|||||||.||||::||||:|
  Fly    82 DKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMS 146

  Fly   139 QGFRLNVVVSRAKILGNAELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGGINVIT 203
            ..:..|||..:|:|.|.::|.:|:||||||||..||.|.....|:||||..:::..   |.|.|.
  Fly   147 LSYTFNVVELKAEIFGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGK---GENEID 208

  Fly   204 ERSTR-----------TSKLLIAKATPADSGNYTCSPSSSDSASVVVHVINGEHPAAMQHGNSS 256
            ....|           ||:|.|.:|.|.|:|||||.|:.:.::||.||||.|||||||||.:||
  Fly   209 SSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAMQHNSSS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 60/92 (65%)
IG_like 53..145 CDD:214653 59/91 (65%)
ig 153..227 CDD:278476 33/84 (39%)
IG_like 161..>227 CDD:214653 31/76 (41%)
dpr1NP_001286645.1 Ig 59..154 CDD:299845 60/94 (64%)
IG_like 60..150 CDD:214653 59/89 (66%)
IG_like 163..257 CDD:214653 38/96 (40%)
Ig 174..244 CDD:143165 28/72 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.